KEGG   Micromonospora aurantiaca: Micau_2979Help
Entry
Micau_2979        CDS       T01296                                 

Definition
glycoside hydrolase family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mau  Micromonospora aurantiaca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Micau_2979
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Micau_2979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3376750..3378216)
Genome map
AA seq 488 aa AA seqDB search
MFSIPRPSRRHLLVGGAVGALALAATAVLPSPDAMAATGCAVTYTTNSWQGGFTATVAVR
NLGDPVSNWTLGFTFPDGGQRVVQGWSATWQQSGSAVTARSLDYNGALGTGASTTIGFNG
SWTGSNPSPTSFTLNGTVCTGGTSTPPPSTPPPSTPPPPTTPPPTTPPPTTPPPTGTTPV
AINGQLQVCGVNLCNQYGRPIQLRGMSTHGLQWFANCYTDASLDVLANEWRSDLLRISMY
VQEQGYETNPAGFTNQVNTLVDKAEARGMYALIDFHTLTPGDPMYNLDRAKTFFANVSAR
NAAKKNVIYEITNEPNGVSWSTIRNYAEQVIPVIRANDPDAVVIVGTRGWSSLGVSEGGN
SDEIVNNPVRAQNIMYTFHFYAASHKDNYRNEVQRAASRLPLFVTEFGTVTYTGDGAVDT
ASSNAWLDLLDRLKISYANWTLSDAPEGSAALRPGTCASGSFGGTSVLTESGAFMRERIR
TADNFPTL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgattccccgcccgtcccggcggcacctgctcgtcggcggcgcggtcggcgcg
ctcgccctggcggcgacggccgtcctgccctcgccggacgcgatggcggcgaccggctgt
gccgtcacctacaccaccaactcctggcaaggcggcttcaccgcgacagtggcggtgcgc
aacctcggcgacccggtgagcaactggacgctgggcttcaccttccccgacggcggccag
cgcgtggtccagggctggtcggccacctggcagcagagcggctcggcggtcaccgcgcgc
agcctggactacaacggcgcgctcggcaccggcgcgagcaccacgatcggcttcaacggc
tcgtggaccgggtcgaacccgagccccacgtcgttcacgctcaacggcacggtctgcacc
ggcggcacgagcaccccgccgcccagcacgcccccgccgagcaccccgccgccgccgacc
actcccccgcccaccaccccgccacccaccaccccgccgccgaccggcaccacgccggtg
gcgatcaacggccagctccaggtgtgcggcgtcaacctctgcaaccagtacgggcggccg
atccagctgcgcggcatgagcacgcacgggttgcagtggttcgccaactgctacaccgac
gcctcgctcgacgtgctcgcgaacgagtggcggtccgacctgctgcgcatctccatgtac
gtgcaggagcagggctacgagaccaacccggccggcttcaccaaccaggtgaacacgctc
gtggacaaggccgaggcccggggcatgtacgcgctcatcgacttccacacgctgacgccc
ggcgacccgatgtacaacctggaccgggcaaagacgttcttcgccaacgtgtccgcgcgc
aacgccgccaagaagaacgtgatctacgagatcaccaacgagcccaacggggtgagctgg
tcgaccatccgcaactacgccgagcaggtcatcccggtgatccgggccaacgacccggac
gcggtggtcatcgtcggcacccggggctggtcctcgctgggtgtctccgagggcggcaac
tccgacgagatcgtgaacaacccggtgcgggcgcagaacatcatgtacacgttccacttc
tacgccgcgtcgcacaaggacaactaccgcaacgaggtgcagcgggcggcgagccggctc
ccgctgttcgtcaccgagttcggcactgtcacctacaccggtgacggcgctgtcgacacc
gccagcagcaacgcctggctcgacctgctcgaccggttgaagatcagctacgcgaactgg
acgctctccgacgcgcccgagggctcggcggcgctccggccgggcacctgcgcgtccggc
tcgttcggcgggacgtcggtgctcaccgagtccggcgcgttcatgcgcgagcgcatccgt
accgccgacaacttccccaccttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system