KEGG   Micromonospora aurantiaca: Micau_3046Help
Entry
Micau_3046        CDS       T01296                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00220  Arginine biosynthesis
mau00330  Arginine and proline metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01130  Biosynthesis of antibiotics
mau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Micau_3046
   00330 Arginine and proline metabolism
    Micau_3046
Enzymes [BR:mau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Micau_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADL46576
JGI: Micau_3046
UniProt: D9TBH1
Position
complement(3450708..3451598)
Genome map
AA seq 296 aa AA seqDB search
MDPRQWMVVGAPSSAGAHTPGIERAPAALRAAGLLDQLGADVEDAGDVPGFRWRPDPAYP
RGQNAGAVAAVASAVADRVAAALGRGRAPLVLGGDCTVTVGLVAGCARAGLSPALVYVDG
GPDLYTPETRANGNLDAMGLAHMLGLPGTLPEVAGVGPEVPLLPPERVVVYGDSLPRGDH
ERELVAELGLAYVPADEVHADARAAARRARSVAEGAAERFVVHFDVDVLSFVDAPLADVP
EPFGLSLGEAAATLAELVASPRFAGLSVTEINPDHLPDDELLPRFAGVLAGTLTGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaccctcgtcagtggatggtcgtcggagcgccgtcgagcgcaggcgcccacaccccg
ggtatcgagcgtgcacccgccgccctgcgcgccgcgggtctgctcgaccagctgggcgcc
gacgtggaggacgccggtgacgtgccgggcttccggtggcggccggatccggcgtacccc
aggggtcagaacgcgggcgcggtggccgccgtcgcctcggcggtggccgaccgggtcgcg
gcggcgctgggccggggccgtgcgccgctggtgctcggcggcgactgcacggtgaccgtc
ggcctggtcgcgggttgcgcgcgggccgggctgtcgcccgcgctggtgtacgtggacggc
gggccggatctctacacgccggagacccgcgccaacggcaacctggacgcgatggggctg
gcgcacatgctcggcctgccgggaacgctgcccgaggtggcgggcgtcgggccggaggtg
ccgctgctgccgccggagcgggtggtggtgtacggggactcgctgccccgcggtgaccac
gaacgcgagctggtggccgagctggggcttgcgtacgtgccggccgacgaggtgcatgcc
gacgctcgggcggcggcgcgccgggcccggtcggtggccgagggtgcggccgaacggttc
gtggtgcacttcgacgtggacgtgctgagtttcgtggacgcgccgctggcggacgtgccg
gagccgttcgggctcagcctcggcgaggcggcggcgacgctggcggagctggtggcgagc
ccgcggttcgccgggttgtcggtcaccgagatcaacccggatcatctgcccgacgacgag
ctgctcccccggttcgccggggtgctggccgggacgctgaccgggcgctag

DBGET integrated database retrieval system