KEGG   Micromonospora aurantiaca: Micau_3246Help
Entry
Micau_3246        CDS       T01296                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Micau_3246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_3246
  Lipid metabolism
   00071 Fatty acid degradation
    Micau_3246
  Amino acid metabolism
   00350 Tyrosine metabolism
    Micau_3246
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Micau_3246
   00626 Naphthalene degradation
    Micau_3246
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Micau_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3654078..3655112
Genome map
AA seq 344 aa AA seqDB search
MRAVRMTAPGVLEHTEVPTPQAGPGEVLLRVGAVGACHSDLHILDAPAGVFPIPMTLGHE
IAGTVDTVGPGVDGWSPGDRAAVYGIIGCGRCRACLRGEENRCRVIPVGGIGLSRDGGLA
EYVVVPASRLLPVGDMDLTQAAPLTDAGLTPYHAVDLARPRLRPGTSCVVIGIGGLGHMG
LQILLATTAVRIIAVDTNTAALDLAGRLGAHHTVQAGPDAVEKIRELVGPAPDGADVVLD
FVGAQPTLDTARQVVATGGQILLVGLAGGTLPVRPVADEPPPVPLETGVVVPFWGTRAEL
HEVIALARDGRLHADVHTFPLAEAPQAYEALRRGEVRGRAVIVP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtacggatgaccgcacccggtgtgctggagcacacggaggtgcccacgccg
caggccggcccgggtgaggtgctgctgcgcgtcggcgcggtcggcgcctgccactccgac
ctgcacatcctcgacgccccggcgggcgtgttcccgatcccgatgacgctcggtcacgag
atcgccggcaccgtcgacacggtcggccccggcgtggacggctggtcgcccggcgaccgg
gccgccgtctacgggatcatcggctgcggccggtgccgggcctgcctgcggggcgaggag
aaccgctgccgggtcatcccggtcggcggcatcgggctcagccgcgacggcgggctggcc
gagtacgtggtggtgcccgcgtcccggctgctgccggtcggcgacatggacctgacccag
gcggcgccgctcaccgacgccgggctgacgccgtaccacgcggtggacctggcgcggccc
cggctgcgacccggcacctcctgcgtggtgatcggcatcggcggcctggggcacatgggg
ttgcagatcctgctcgccaccacagcggtacggatcatcgcggtggacaccaacaccgcc
gcgctggacctggccggccgcctcggcgcgcaccacacggtgcaggccggcccggacgcg
gtggagaagatccgcgaactggtcggaccggcgccggacggcgcggacgtggtgctcgac
ttcgtcggcgcgcagcccacgctggacaccgcccggcaggtcgtcgccaccggcggccag
atcctgctggtgggcctggccggcggcacgctgccggtgcgcccggtcgccgacgagccg
cccccggtgccgctggagaccggtgtggtggtgccgttctggggcacccgggccgaactg
cacgaggtgatcgcgctggcccgcgacggccggctgcacgccgacgtgcacacgttcccc
ctcgcggaggcgccgcaggcgtacgaggcgctgcgccggggcgaggtgcgagggcgggcg
gtcatcgtcccctga

DBGET integrated database retrieval system