KEGG   Micromonospora aurantiaca: Micau_3645Help
Entry
Micau_3645        CDS       T01296                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mau  Micromonospora aurantiaca
Brite
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Micau_3645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4075160..4076353
Genome map
AA seq 397 aa AA seqDB search
MKLRRWLAAGAVAVATATALNVVPATAGRPYDPAAQSLRELAKRHGLYVGTAVDMAALND
AAEPRYRELAASEFSTVTAENVMKWESLEPTRGTYNWGPADELIDFARKNNQRVRGHVLV
WHNQLPAWLTSGVADGSISKAELRQILRNHITAVVTHFKGKIWQWDVVNEAVSDPWDTPS
TLHYKGFWAQNLGPGYIADAFRWARAADPKALLFYNDYNIEAFGSGNPADDKTQFVYDMA
RDLRAKGVPIDGVGAQGHLGTQYGNFSTLQVAAALRKFAGLGLATALTEVDVRSQITEGV
EAGDSAEINPRLQASAANFSVLMQACLAERHCLSFTLWGFTDKHSWVPGAFSDPPEGLAT
VYDENYQPKRAYHELKADLIFSGPPYVLPRIPQHPRR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagacgttggctcgccgccggcgccgtcgccgtcgcgaccgccaccgccctc
aacgtcgtccccgcgacggccggccgcccctacgacccggccgcgcagagcctgcgcgag
ctggccaagcgccacggcctgtacgtgggcaccgccgtcgacatggccgccctcaacgac
gccgccgagccgcggtaccgcgagctggccgcgtccgagttctccaccgtcaccgccgag
aacgtcatgaagtgggagagcctcgaacccacccggggcacatacaactgggggccggcc
gacgagctgatcgacttcgcccgcaagaacaaccagcgggtccggggccacgtgctggtc
tggcacaaccagttgccggcgtggctgaccagcggcgtcgcggacggctcgatcagcaag
gccgagctgcgccagatcctgcgcaaccacatcaccgccgtggtcacccacttcaagggc
aagatctggcagtgggacgtggtgaacgaggcggtcagcgacccctgggacaccccgtcc
accctgcactacaaggggttctgggcgcagaacctcgggcccggctacatcgccgacgcg
ttccgctgggcccgcgccgccgacccgaaggcgctgctgttctacaacgactacaacatc
gaggcgttcggctccggcaacccggccgacgacaagacgcagttcgtctacgacatggcc
cgtgacctgcgggccaagggcgtgccgatcgacggcgtgggcgcacagggccacctcggc
acccagtacggcaacttcagcacgctccaggtggccgcggccctgcgcaagttcgccggg
ctcgggctggccacggccctcaccgaggtggacgtgcgcagccagatcaccgagggggtg
gaggccggcgactccgcggagatcaacccgcgtctgcaggcgtccgcggcgaacttcagc
gtgctgatgcaggcctgcctggccgagcggcactgcctgtcgttcaccctctggggcttc
accgacaagcactcctgggtacccggcgcgttctccgacccgccggagggcctggccacc
gtctacgacgagaactaccagccgaagcgggcgtaccacgagctgaaggccgacctgatc
ttctccggtccgccatacgtgctgccgcgcatcccgcagcacccgcgccgctag

DBGET integrated database retrieval system