KEGG   Micromonospora aurantiaca: Micau_3713Help
Entry
Micau_3713        CDS       T01296                                 

Definition
Prenyltransferase/squalene oxidase
Orthology
K06045  
squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
mau  Micromonospora aurantiaca
Pathway
Sesquiterpenoid and triterpenoid biosynthesis
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Sesquiterpenoid and triterpenoid biosynthesis [PATH:mau00909]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4160487..4162187)
Genome map
AA seq 566 aa AA seqDB search
MTAVTAEAVGKALTAGAEALFRRRRPDGAFSDDPPASVLGTAGAVAALHAADPSGCADLV
DAGTAWLRRAQHDDGGWGGVVGAGTAVVPTAVAVAALALSAPADSADAIAAGRARLAALG
GVDTITDPAISLLCRQLLTMAGMTAEAGPLRRLPLEIVLFDRVRRQRLSFRTAPFVGLAL
MQADMLPAGRLRRATLRRARPAAVRLLRSIHDHEGRTGALSEDPWPAALVLLGLARSGEA
PDIARAVVGWLRRAVRPDGSWDAVSNLDLTRSGYAATGLIAAGYADDPRLHATREFLHAA
RKTEAFEVLDVPPGGWSYSNARGWPVTLESAEILSALAGLPGAGTDPVLRQGLAWLVGRQ
DSRGSWSLWVRDTRLPNDGPCPAITSQAILALHDAGHPDDHPAIARAAAWLLTRAAPDGT
FENLWYRDHTSGTAVVVAALSRVGHARHEVVRRAARWLRDTQLPDGSWGPGDGTGGTVEE
TSWAVQGLLATGDPDAADAVDRGVAWLVAAAGPDGAWPAARVCNYIRHHMRYPNAVITQA
LALRTLGEYRRAAATRSGAAPGAMAR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtgaccgccgaggccgtcgggaaggccctcaccgctggtgccgaggcgctg
ttccgtcgccgccgccccgacggcgccttcagcgacgacccacccgcctcggtgctcggc
accgctggcgctgtcgccgcgctgcacgccgccgacccgtccggctgcgccgacctggtc
gacgccggaaccgcctggctgcgccgcgcgcagcacgacgacggcggctggggtggcgtc
gtgggcgccggcaccgccgtcgtacccaccgccgtggcggtcgccgcgctggcgctgagc
gcaccggctgacagtgccgacgcgattgcggcgggccgcgcccggctggccgcgctcggc
ggcgtcgacaccatcaccgatccggcgatctcgctgctgtgccggcaactgctcaccatg
gccgggatgacagccgaggccggcccgctgcgccggctgccgctggagatcgtcctgttc
gaccgggtacgccggcagcgcctgtcgttccgtaccgcgccgttcgtcgggctggccctg
atgcaggccgacatgctgcccgcgggccggctgcgccgggccacgctgcgccgcgcccgt
ccggcggcggtacggctgctgcggtccatccacgaccacgagggccgcaccggagcgctc
agcgaggacccgtggccggccgcgctcgtcctgctcggtctggcccgcagcggcgaggcg
cccgacatcgcccgcgccgtcgtcggctggctgcgccgggcggtacgccccgacggatcc
tgggacgcggtcagcaacctggacctcacccggtccgggtacgcggcgaccgggctgatc
gcggccggctacgccgacgatccccggctgcacgccacccgggagttcctccacgccgcc
cgcaagacggaggcgttcgaggtgcttgacgtgccgccgggcgggtggagctactcgaac
gcccggggctggccggtcacgctggagtcggccgagatcctctccgcgctcgccggactc
cccggtgccggcaccgacccggtgctgcgccagggactggcgtggctcgtcggccgccag
gacagccgcggctcgtggagcctgtgggtccgcgacacccggctccccaacgacggaccc
tgcccggccatcaccagtcaggcgatcctcgcgctgcacgacgccgggcatccggacgac
catccggcgatcgcccgcgcggcggcctggctgctcacccgggccgcgcccgacggcacg
ttcgagaacctctggtaccgcgaccacacctccggcaccgcggtggtggtcgccgcgctg
tcccgggtcgggcacgcccggcacgaggtggtgcgccgcgcagcccggtggctgcgcgac
acccagctgcccgacggctcgtggggcccgggcgacggcaccggcggcactgtggaggag
acgtcctgggcggtgcagggcctgctcgcgaccggcgatccggacgccgccgacgcggtg
gaccggggcgtcgcctggctggtggccgccgccggaccggacggcgcctggcccgccgcc
cgggtgtgcaactacatccgccaccacatgcggtacccgaacgcggtgatcacccaggcg
ctcgcgctgcggacgctcggcgagtaccgccgggccgccgccacgcggtccggcgccgca
ccgggggcgatggcccgatga

DBGET integrated database retrieval system