KEGG   Micromonospora aurantiaca: Micau_4005Help
Entry
Micau_4005        CDS       T01296                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
mau  Micromonospora aurantiaca
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Micau_4005
   01055 Biosynthesis of vancomycin group antibiotics
    Micau_4005
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Micau_4005
Enzymes [BR:mau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     Micau_4005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4547284..4547916
Genome map
AA seq 210 aa AA seqDB search
MSSTMQARALKVEGAVEFTPRVFPDDRGIFVSPFQETAFVEALGHPLFPVAQTNHSRSRK
GVVRGAHFTLTPPGIAKYVYCARGKTIDFVVDIRVGSPTFGQFDQVLLDQEAFRAVYLPV
GVAHAFAALEDDTVVSYMLSDGYVEAHEKAVNVLDPALNLPLPTGVERVLSDRDRSAPTI
EEARRLGLLPDYAQCQKLESELFAAPRGRE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaccatgcaggcccgcgcactgaaggtcgaaggcgccgtcgaattcacccca
cgggtcttccccgacgaccgcgggatcttcgtctcacccttccaggagaccgccttcgtc
gaggcgctcggccacccactctttccggtggcccagaccaaccacagccgctcacgcaag
ggcgtggtccggggcgcgcacttcaccctcaccccgcccggaatcgccaagtacgtgtac
tgcgcgcggggcaagacgatcgatttcgtcgtggacatccgagtcggttccccgaccttc
gggcagttcgatcaggtcctgctcgaccaagaggcgttccgggccgtctacctgccggtt
ggcgtggcccacgccttcgccgcgctcgaggacgacaccgtcgtgtcgtacatgctctcc
gacggctacgtcgaggcgcacgaaaaggcggtcaacgtgctggacccggcgctgaatctg
ccgctgccgaccggcgtcgagcgggtgctctccgatcgggacaggtccgcgcccacgatc
gaggaggcccgcagactgggcctgctaccggactacgcacagtgccagaagctggagagc
gaactgttcgccgcgccccggggtcgcgagtga

DBGET integrated database retrieval system