KEGG   Micromonospora aurantiaca: Micau_4120Help
Entry
Micau_4120        CDS       T01296                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mau  Micromonospora aurantiaca
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4667987..4669228
Genome map
AA seq 413 aa AA seqDB search
MVGSVLDTSSADEARARLADRLVAGRRITSPAVEAAFRRVPRHLFATDGVSVDAAYADDV
VITRRDRDGRATSSISAPWLQAYMLEQAGLRPGARVLEIGSGGYNAALIADVVGPDGMVV
TVDIDADVIDRARTGLDHAGYRQVTVVHGDGEYGHQPGAPYDAIIVTVETPDVAPAWLDQ
LAPAGALLVPLRIRGMTRCLTLRRHEDHLRATAALQCGFVPMQGDGRHPTRRLALRGDDI
VVHLDDTSTEVSRDALTAALHTRRLDAWSPVTIAISDGSSFESLHLWLASQPRPFGTLTV
DRERAAGLVDPQDRFVCPTLLTTGSFAYLAMRTLDDTTWQFGAHGFGPDADTLTADMLDL
ITVWDHHHRHGPGPTITVHPTGTHPPTPDGSQLLVTRRHAAITVTWSAPEQPQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggttggttccgtgctcgacaccagctccgccgatgaggcccgtgcccggctcgccgac
cggctcgttgccggccggaggatcacctcgccggcggtggaggcggcgtttcgccgggtg
cctcgacatctgttcgccaccgacggcgtcagcgtcgacgccgcgtacgccgatgatgtg
gtcatcaccagacgcgaccgggacgggcgggcgacgagttcgatctccgcgccgtggctg
caggcgtacatgctggaacaggccgggctgcggcccggcgcccgggttcttgagatcggc
tccggtggctacaacgccgcgctgatcgccgacgtcgtcggcccggacggcatggtcgtc
accgtcgacatcgacgccgacgtcatcgaccgcgcccgcaccggcctggaccatgccggc
taccggcaggtgacggtcgtacacggtgacggcgagtacggacaccagcccggcgccccg
tatgacgccatcatcgtcaccgtggagacaccggatgttgcaccggcctggctcgaccag
ctcgccccggccggtgcgctcctcgtgccgctgcggatacgcggcatgacccggtgcctc
accctgcgacgccacgaggatcatcttcgggccactgcggcgctgcagtgcgggttcgtg
ccgatgcagggcgacggacgccatcccacccgccgcctggccctgcgcggcgacgacatc
gtcgtgcacctggacgacaccagcaccgaggtgagccgggacgccctcaccgcggcgcta
cacacgcgccggctggacgcctggtcgccggtcaccatcgccatcagtgacgggtcttcg
ttcgagtcgctgcacctgtggctggccagccagccccggcccttcggcacgctcaccgtc
gaccgcgaacgcgccgcgggcctggtcgacccgcaagaccggttcgtctgcccgaccctg
ctcaccaccggcagcttcgcctacctcgcgatgcgcacactcgacgacaccacctggcag
ttcggcgcccacggcttcggacccgacgccgacaccctgaccgccgacatgctcgacctc
atcacggtctgggaccaccaccaccgacacggccccggcccgaccatcaccgtgcacccc
accggcacccacccgcccacacccgatggatcccaactgctcgtcacccgccgccacgcc
gcgataaccgtcacctggtccgctccggagcagccgcagtga

DBGET integrated database retrieval system