KEGG   Micromonospora aurantiaca: Micau_4335Help
Entry
Micau_4335        CDS       T01296                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Micau_4335
   01230 Biosynthesis of amino acids
    Micau_4335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_4335
   00051 Fructose and mannose metabolism
    Micau_4335
   00562 Inositol phosphate metabolism
    Micau_4335
Enzymes [BR:mau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Micau_4335
Exosome [BR:mau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Micau_4335
  Exosomal proteins of bladder cancer cells
   Micau_4335
  Exosomal proteins of melanoma cells
   Micau_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4910538..4911329)
Genome map
AA seq 263 aa AA seqDB search
MASTTRRPLMAGNWKMNLNHLEANLLVQKLAASLNEKQLTDVECVVLPPFTDLRTVQTAV
DGDKLLIGYGAQDLSPHPSGAYTGDIAGPMLAKLGCGYVVVGHSERRQYHNEDDALVNAK
VSAALANGLTPILCIGEGLEVREQSGQVRHCCDQLDGALKGLTAEQVTKVVVAYEPVWAI
GTGKTATPDDAQEVCGAVRKRIAETYDEGTAEQVRILYGGSVKASNVAAIMAQPDVDGAL
VGGASLDAEEFAQICRFPEHITR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacgacccgccggccgctgatggccggcaactggaagatgaacctgaaccac
ctcgaggccaacctgctggtgcagaagctggccgcgagcctgaacgagaagcagctcacc
gacgtcgagtgcgtggtgctgccgcccttcaccgacctgcgtaccgtgcagaccgccgtg
gacggcgacaagctgctgatcggctacggcgcgcaggacctgtcgccgcacccgtccggc
gcgtacaccggtgacatcgccgggccgatgctcgccaagctgggctgcggctacgtggtg
gtcgggcactccgagcggcggcagtaccacaacgaggacgacgcgctcgtcaacgcgaag
gtgtcggcggcgctggcgaacgggctcaccccgatcctctgcatcggtgagggcctggag
gtccgggagcagtcgggtcaggtgcggcactgctgcgaccagctcgacggcgcgctgaag
gggctcaccgccgagcaggtcaccaaggtcgtcgtggcgtacgagccggtctgggcgatc
ggcaccggcaagacggcgaccccggacgacgcccaggaggtctgcggcgcggtgcgcaag
cgcatcgccgagacctacgacgagggcaccgccgagcaggtccggatcctgtacggcggg
tcggtcaaggcgtcgaacgtcgccgcgatcatggcgcagccggacgtggacggggctctg
gtcgggggcgccagcctggacgcggaggagttcgcgcagatctgccggttcccggagcac
atcacccgctga

DBGET integrated database retrieval system