KEGG   Micromonospora aurantiaca: Micau_4423Help
Entry
Micau_4423        CDS       T01296                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Micau_4423
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_4423
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Micau_4423
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Micau_4423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5016473..5017699)
Genome map
AA seq 408 aa AA seqDB search
MSAAPATGQVPDAAGHFGRFGGRFVPEALVAALDELDAAYRKAMGDEDFLAEFDALLRDY
AGTPSMLYEARRFSAQIGARVLLKREDLNHTGAHKVRNVLGQALLTRRMGKRRVIAETGA
GQHGVATATAAALFDLECVVYMGQVDTERQALNVARMRMLGATVVPVTTGSRTLKDAMNE
AMRDWVANVDSTHYLIGTAAGPHPFPEMVRDFVRGIGEEARRQCLDLTGALPDAVAACVG
GGSNALGIFHAFVPDAGVRLYGFEAGGEGVDTGRHAASITGGSSGVLHGTRTYVLQDADG
QTIESHSISAGLDYPGVGPEHAWLHDTGRATYLPVDDADAMAAFELLCRTEGVIPAIESA
HALAGARAIAPRLAEELGREPVIVVNLSGRGDKDVHTAGAYFGILDKE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcacccgcaaccggccaggtccccgacgccgccggtcacttcggccggttc
ggcggccggttcgtccccgaggcgctcgtcgccgcgctcgacgagctggacgcggcgtac
cggaaggcgatgggcgacgaggacttcctcgccgagttcgacgcgctgctgcgcgactac
gccggcacgccctcgatgctctacgaggcccggcggttctccgcgcagatcggcgcgcgg
gtcctgctcaagcgggaggacctcaaccacaccggcgcgcacaaggtccgtaacgtgctg
ggccaggcgctgctcaccaggcggatgggcaagcggcgggtcatcgcggagaccggcgcc
ggccagcacggcgtcgccaccgccaccgccgccgcgctgttcgacctggaatgcgtcgtc
tacatgggccaggtggacaccgagcggcaggcgctgaacgtggcgcggatgcggatgctc
ggcgccactgtcgtcccggtgaccaccggctcgcgcacgctcaaggacgcgatgaacgag
gcgatgcgggactgggtcgccaacgtcgacagcacccactacctgatcggcaccgccgcc
gggccgcacccgttcccggagatggtccgcgacttcgtgcgcggcatcggcgaggaggcg
cgccggcagtgcctggacctgaccggcgcgctgccggacgcggtggcggcctgcgtcggc
ggcggctccaacgcgctgggcatcttccacgcgttcgtgccggacgccggggtccggctc
tacggcttcgaggccggcggcgagggcgtcgacaccggccggcacgccgccagcatcacc
ggcggctcgtccggcgtgctgcacggcacccgcacgtacgtcctccaggacgccgacggc
cagaccatcgagtcgcactcgatctcggccggcctggactacccgggcgtcgggccggag
cacgcctggctgcacgacaccggccgggccacctacctgccggtcgacgacgccgacgcg
atggccgcgttcgagctgctctgccgcaccgagggcgtgatcccggcgatcgagagcgcg
cacgcgctcgccggcgcccgcgcgatcgccccccggctcgccgaggagctgggccgggag
ccggtgatcgtggtcaacctgtccgggcggggcgacaaggacgtgcacaccgccggcgcg
tacttcggcatcctcgacaaggagtga

DBGET integrated database retrieval system