KEGG   Micromonospora aurantiaca: Micau_4424Help
Entry
Micau_4424        CDS       T01296                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01130  Biosynthesis of antibiotics
mau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Micau_4424
Enzymes [BR:mau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Micau_4424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE OMPdecase QRPTase_C PDZ IMPDH
Motif
Other DBs
NCBI-ProteinID: ADL47937
JGI: Micau_4424
UniProt: D9T632
Position
complement(5017734..5018597)
Genome map
AA seq 287 aa AA seqDB search
MTAEHAHAEGDDAGAAPSAGVLDEILAGVREDVARRQEQVPLERIRELAAAAPPPLDAYA
ALRRPGVAVIAEVKRSSPSKGRLAEIADPADLAGDYAAGGARAISVLTEGRWFGGSLDDL
AAVRAAVNVPVLRKDFVVSSYQVHEARAHGADLVLLIVAALEQNVLVGLLERIESLGMTA
LVEVHTEEEADRALEAGAQVIGVNARDLRTLEVDRSVFERIAPGLPSSVVKIAESGVRGP
HDLIRYASAGADAVLVGEGLVTQKSPREAVAELVNAGNHPATPRPVR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgagcatgcgcacgcggagggggacgacgccggagcggcgccgtccgcaggg
gtgctcgacgagatcctggccggcgtgcgcgaggacgtggcccggcgccaggagcaggtt
ccgctggagcggatccgtgaactggccgccgccgcgccgccaccgctcgacgcgtacgcg
gccctgcgccgccccggcgtggccgtgatcgccgaggtgaagcgctcgtcgccgtccaag
gggcggctggccgagatcgccgacccggccgacctggccggtgactacgcggccggtggc
gcgcgggcgatcagcgtgctgaccgagggccgctggttcggcgggtcgctcgacgacctc
gccgcggtgcgggccgcggtgaacgtgccggtgctgcgcaaggacttcgtggtctccagc
taccaggtgcacgaggcccgcgcgcacggcgccgacctggtgctgctgatcgtggccgcg
ctggagcagaacgtgctggtcgggctgctggagcggatcgagtcgctcggcatgaccgcg
ctggtcgaggtgcacaccgaggaggaggcggaccgcgccctggaggccggcgcgcaggtc
atcggcgtgaacgcccgcgacctgcgtaccctggaggtcgaccgctccgtgttcgagcgg
atcgcgcccggcctgcccagcagcgtcgtcaagatcgctgagtccggggtgcgcggtccg
cacgacctgatccggtacgcctccgccggcgccgacgccgtgctggtgggcgagggcctg
gtcacccagaagagcccgcgcgaagccgtcgccgagctggtcaacgccggtaaccacccg
gccacgccccgcccggtgcgctga

DBGET integrated database retrieval system