KEGG   Micromonospora aurantiaca: Micau_4424Help
Entry
Micau_4424        CDS       T01296                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mau  Micromonospora aurantiaca
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Micau_4424
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Micau_4424
Enzymes [BR:mau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Micau_4424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5017734..5018597)
Genome map
AA seq 287 aa AA seqDB search
MTAEHAHAEGDDAGAAPSAGVLDEILAGVREDVARRQEQVPLERIRELAAAAPPPLDAYA
ALRRPGVAVIAEVKRSSPSKGRLAEIADPADLAGDYAAGGARAISVLTEGRWFGGSLDDL
AAVRAAVNVPVLRKDFVVSSYQVHEARAHGADLVLLIVAALEQNVLVGLLERIESLGMTA
LVEVHTEEEADRALEAGAQVIGVNARDLRTLEVDRSVFERIAPGLPSSVVKIAESGVRGP
HDLIRYASAGADAVLVGEGLVTQKSPREAVAELVNAGNHPATPRPVR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgagcatgcgcacgcggagggggacgacgccggagcggcgccgtccgcaggg
gtgctcgacgagatcctggccggcgtgcgcgaggacgtggcccggcgccaggagcaggtt
ccgctggagcggatccgtgaactggccgccgccgcgccgccaccgctcgacgcgtacgcg
gccctgcgccgccccggcgtggccgtgatcgccgaggtgaagcgctcgtcgccgtccaag
gggcggctggccgagatcgccgacccggccgacctggccggtgactacgcggccggtggc
gcgcgggcgatcagcgtgctgaccgagggccgctggttcggcgggtcgctcgacgacctc
gccgcggtgcgggccgcggtgaacgtgccggtgctgcgcaaggacttcgtggtctccagc
taccaggtgcacgaggcccgcgcgcacggcgccgacctggtgctgctgatcgtggccgcg
ctggagcagaacgtgctggtcgggctgctggagcggatcgagtcgctcggcatgaccgcg
ctggtcgaggtgcacaccgaggaggaggcggaccgcgccctggaggccggcgcgcaggtc
atcggcgtgaacgcccgcgacctgcgtaccctggaggtcgaccgctccgtgttcgagcgg
atcgcgcccggcctgcccagcagcgtcgtcaagatcgctgagtccggggtgcgcggtccg
cacgacctgatccggtacgcctccgccggcgccgacgccgtgctggtgggcgagggcctg
gtcacccagaagagcccgcgcgaagccgtcgccgagctggtcaacgccggtaaccacccg
gccacgccccgcccggtgcgctga

DBGET integrated database retrieval system