KEGG   Micromonospora aurantiaca: Micau_4455Help
Entry
Micau_4455        CDS       T01296                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00340  Histidine metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01230  Biosynthesis of amino acids
Module
mau_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Micau_4455
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Micau_4455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADL47968
JGI: Micau_4455
UniProt: D9T663
Position
complement(5045473..5046798)
Genome map
AA seq 441 aa AA seqDB search
MLNRIDLRGGARDPRRLLPRAQLDVSVAVERIRPLVEAVRDHGYPAIREASERFDGVSPE
RLRVPVETIRAAEDELDPQVRAALLESITRARKVHADQRRTDHTTTVVPGGTVTERWVPV
DRVGLYVPGGLAMYPSTVVMNVVPAQAAGVRSLVVVSPPQKDNDGLPDRRVLAACALLGV
DEVYAVGGAQAVAMLAYGAGVDPAGDERCEPVDMITGPGNIWVTAAKRLLRGVVGIDAEA
GPTEIAILADDTADPAHVAADLISQAEHDPLAASVLVTPSTALADAVDAELARQAPAAKH
AERIGTALRGEQSGVVLVDDLEAGLRVVDAYAAEHLEIQTENAREWALRVRNAGAVFVGA
WSPVSLGDYCAGSNHVLPTGGCARHSSGLSVQSFLRGVHLVEYTQDALRDVAPHVVTLAT
VEDLPAHGQAVSVRFPGGGAS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaatcggatcgacctgcgcggcggggcccgtgacccgcgccgcctgctgccccgt
gcccagctcgacgtctccgtggcggtcgagcggatccgcccgctcgtggaggcggtccgg
gaccatgggtacccggcgatccgggaggcgagcgaacggttcgacggcgtctcgccggag
cggctgcgggtgccggtcgagacgatccgcgccgccgaggacgagctggacccgcaggta
cgcgccgcgctgctggagtcgatcacccgggcccgcaaggtccacgccgaccagcgccgc
accgaccacaccacgactgtggtgcccggcggcactgtgaccgagcggtgggtgccggtc
gaccgggtcggtctctacgtgcccggcggcctggccatgtacccgtcgacggtggtgatg
aacgtggtcccggcccaggcggccggggtgcgctccctggtggtggtgagcccgccgcag
aaggacaacgacgggctgcccgaccggcgggtcctcgcggcgtgcgcgctgctcggcgtg
gacgaggtgtacgcggtcggcggcgcccaggcggtcgccatgctcgcgtacggcgcgggc
gtcgacccggccggggacgagcgctgcgagccggtcgacatgatcaccggtccgggcaac
atctgggtcaccgccgcgaagcggctgctgcgcggcgtggtcggcatcgacgccgaggcc
ggcccgaccgagatcgcgatcctggccgacgacaccgccgacccggcgcacgtcgcggcc
gacctgatcagccaggccgagcacgacccgctggccgcgagcgtgctggtcaccccgtcc
acggcgctggccgacgcggtcgacgcggagctggcccggcaggcgccggcggccaagcac
gccgagcggatcggcaccgcgctgcgcggcgagcagagcggcgtggtcctggtcgacgac
ctggaggcagggctgcgggtggtcgacgcgtacgcggccgagcacctggagatccagacc
gagaacgcccgcgagtgggcgctgcgggtccgcaacgccggggcggtgttcgtcggcgcc
tggtcgccggtgtcgctcggcgactactgcgcgggctccaaccacgtgctgcccaccggc
ggctgcgcccggcactcctccgggctgtccgtgcagtcgttcctgcgcggcgtgcacctg
gtcgaatacacccaggacgcgctgcgcgacgtggcgccgcacgtggtcacgctggcgacc
gtggaggacctgcccgcgcacggccaggcggtcagcgtccggttccccgggggcggggcg
tcgtga

DBGET integrated database retrieval system