KEGG   Micromonospora aurantiaca: Micau_4603Help
Entry
Micau_4603        CDS       T01296                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mau  Micromonospora aurantiaca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Micau_4603
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Micau_4603
  Amino acid metabolism
   00310 Lysine degradation
    Micau_4603
Enzymes [BR:mau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Micau_4603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5208626..5210488
Genome map
AA seq 620 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIV
VGEDETAEVGSELAVIAGEGEDAGAAPTEKAEPATEPTAAAEGTGPEPEQAQEAEEAAAE
PGAEAEQPAVEEPAEPAAPSGEGTPVTMPALGESVTEGTVTRWLKQVGETVEVDEPLLEV
STDKVDTEIPSPVAGTLQEIKVAEDETADVGAVLAIVGVAGAAPAKAEPKPEPKPEPKAE
AKPEPKPEPKVEEPTPGASYNEPAAEAEQAAQPAKAEQAAQPAEQAAQPAAPAAAQRPSV
PSEYGEDAAGYVTPLVRKLAAEHGVDLGSIKGTGVGGRIRKQDVLEAAEKAKAAKPAPAA
AAAPSAPAPAKPAAKPEPSAKRGTTEKLPRIRSIIAKRLQQSLHETAQLTTVVEVDVTKV
AKLRARAKDSFQAKHGVKLSFLPFFAVAAIEALQTYPIIQASMDLDGGTITYPGAEHLGI
AVDTERGLLTPVIHNAGDLNMGGLAKRIADLAERTRANKITPDEMAGATFTLTNTGSRGA
LFDTPIVPSPQSAMLGTGAVVKRPVVVNDAELGEVVAIRSMVYLALSYDHRLIDGADAAR
FLTAVKERLEGGNFEAELGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtcccccgcggcgggcgtgctgagccggatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcggtcatcgccggcgagggc
gaggacgcgggcgcggctcccacggagaaggccgagccggccaccgagccgacggccgcc
gccgagggcaccggccccgagccggagcaggcccaggaggccgaggaggccgccgccgag
ccgggcgccgaggccgagcagccggccgtcgaggagccggccgagcccgccgcgccgtcg
ggcgagggcacgccggtgaccatgccggccctgggcgagagcgtcaccgagggtactgtc
acccgctggctcaagcaggtcggcgagaccgtcgaggtggacgagccgctgctggaggtc
tccaccgacaaggtcgacaccgagatcccgtcgccggtcgccggcacgctgcaggagatc
aaggtcgccgaggacgagaccgccgacgtcggcgccgtgctggcgatcgtcggggttgcc
ggcgccgcgcccgcgaaggcggagccgaagcccgagcccaagccggagcccaaggccgag
gcgaagcccgaaccgaagccggagccgaaggtcgaggagcccacgccgggcgcgtcctac
aacgagccggccgccgaggcggagcaggccgcgcagccggccaaggccgagcaggcggcc
cagccggccgagcaggcggcccagccggccgcgccggccgccgcgcagcgcccgagcgtt
ccgtccgagtacggcgaggacgccgccgggtacgtgacgccgctggtgcgcaagctcgcc
gccgagcacggcgtggacctgggctcgatcaagggcaccggcgtgggtggccgcatccgc
aagcaggacgtgctggaggcggccgagaaggcgaaggccgccaagcccgcgccggccgcc
gccgctgccccgtccgcacccgccccggccaagccggccgccaagccggagccgagcgcc
aagcggggcaccacggagaagctgccgcggatccgttcaatcatcgccaagcgtctccag
cagtcgctgcacgagacggcgcagctgaccaccgtcgtcgaggtcgacgtcaccaaggtc
gccaagctgcgggcgcgggccaaggactcgttccaggccaagcacggcgtgaagctgtcc
ttcctgccgttcttcgcggtggccgcgatcgaggcgctccagacgtacccgatcatccag
gccagcatggacctggacggcgggacgatcacctacccgggcgccgagcacctgggcatc
gcggtggacaccgagcgcgggctgctcacgccggtcatccacaacgccggtgacctgaac
atgggtggcctggccaagcggatcgccgacctggccgagcgcacccgggccaacaagatc
accccggacgagatggccggggcgacgttcacgctcaccaacaccggcagccggggcgcg
ctgttcgacaccccgatcgtgccgtcgccgcagtcggcgatgctcggcacgggtgccgtg
gtgaagcgcccggtcgtggtgaacgacgcggagctgggcgaggtcgtggcgatccgctcg
atggtctacctggctctgtcgtacgaccaccggctgatcgacggcgccgacgcggcccgc
ttcctcaccgcggtgaaggagcggctggagggcggcaacttcgaggccgagctgggtctg
tag

DBGET integrated database retrieval system