KEGG   Micromonospora aurantiaca: Micau_4701Help
Entry
Micau_4701        CDS       T01296                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Micau_4701
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Micau_4701
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Micau_4701
Enzymes [BR:mau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Micau_4701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5314720..5316363
Genome map
AA seq 547 aa AA seqDB search
MALSRRTILLSGAALGAAGAAAGLPVAAAASPGPLRRDPFTLGVASGDPDHEGFVLWTRL
APEPLAEDGLGGMPSRVVPVSWEVAADERFRHVVRRGVRLARPESAHSVHVELDGLLPGR
EYFYRFRAERWASPAGRTRTAPAPWSMPSALAMGFASCSQYEHGYFTAYRRLAETEPELI
LHLGDYQYEYAKDTYNVPGGNPRDHEGPETRTLANYRQRHAQYKTDTDLQAAHAVAPWVV
VFDDHEVENNWADEVPEAPDPEFPARRAAAFQAYYENMPLRRTSIPRGIDMQLYRRVRWG
RLATFHMLDTRQYRDDQACGDGYKSCAEASDPTRSITGAAQEAWLLDGFRRSEARWDLLG
QQVFFAQRDNNSGPLTVTSMDAWDGYVASRDRITRGWTAAGVRNPVVLTGDVHAHWASDL
KLDYADPTSRTVGSELVCSSITSTGDGADSPTGSHPWLAFNPHLRFQNNLRGYVRTTITP
TELTADFDVLPYVSRPDAPAYTRATFVIEDRVPGLNLTHDRPPAAARTAAPGVDQGRQTV
EAETVRP
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtggctctgtcccgacgtaccatcctgctcagcggcgcggcgctcggcgccgccggcgcg
gcagccggcctgccggtcgcggccgccgcgtcgcccggcccgctgcgccgcgacccgttc
acgctcggcgtggcctccggcgacccggaccacgagggcttcgtgctctggacccggctg
gcgccggagccgctggccgaggacggcctgggcggcatgccgtcgcgggtcgtgccggtg
tcctgggaggtggccgccgacgagcgcttccggcacgtggtgcgccgcggcgtacggctg
gcccggccggagtccgcgcacagcgtgcacgtcgaactggacggcctgctgcccggacgg
gagtacttctaccggttccgggccgaacgctgggcgtccccggccgggcgcacccgcacc
gccccggcgccgtggtcgatgccctccgcgctcgccatgggcttcgcctcctgctcgcag
tacgagcacggctacttcaccgcgtaccggcggctggccgagaccgagccggagctgatc
ctgcacctcggcgactaccagtacgagtacgccaaggacacgtacaacgtccccggcggc
aacccgcgcgaccacgagggcccggagacccggacgctggcgaactaccggcagcggcac
gcccagtacaagaccgacaccgacctccaggcggcgcacgcggtcgcgccctgggtggtg
gtcttcgacgaccacgaggtggagaacaactgggccgacgaggtgcccgaggcgcccgac
ccggagttccccgcacggcgggcggcggcgttccaggcgtactacgagaacatgccgctg
cgccgcacctcgatcccgcgcggcatcgacatgcagctctaccggcgggtgcgctggggc
cggctggccaccttccacatgctcgacacccggcagtaccgggacgaccaggcgtgcggt
gacggctacaagagctgcgccgaggcgtccgacccgacccgctcgatcaccggcgccgcg
caggaggcgtggctgctggacggcttccgccgttccgaggcccgctgggacctgctcggc
cagcaggtgttcttcgcccagcgggacaacaactccggtccgctgacggtgacgagcatg
gacgcctgggacgggtacgtcgcatcccgggaccggatcacccggggctggacggccgcc
ggggtgcgcaacccggtggtgctcaccggcgacgtgcacgcgcactgggccagtgacctg
aagctggactacgccgacccgacctcgcgcaccgtcggcagcgagctggtctgctcgtcg
atcacctcgaccggggacggcgccgactcgccgaccggctcgcacccgtggctggcgttc
aacccgcacctgcgcttccagaacaaccttcgggggtacgtccgcaccacgatcaccccg
accgagctgaccgccgacttcgacgtcctgccgtacgtgagccgaccggacgcgcccgcg
tacacccgggccacgttcgtgatcgaggaccgcgtacccgggctgaacctgacccacgac
cggccgccggccgcggcgcgcaccgccgcccccggcgtcgaccagggccggcagacggtg
gaggcggagacggtccgcccgtga

DBGET integrated database retrieval system