KEGG   Micromonospora aurantiaca: Micau_4939Help
Entry
Micau_4939        CDS       T01296                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00360  Phenylalanine metabolism
mau00362  Benzoate degradation
mau00620  Pyruvate metabolism
mau00621  Dioxin degradation
mau00622  Xylene degradation
mau00650  Butanoate metabolism
mau01100  Metabolic pathways
mau01120  Microbial metabolism in diverse environments
mau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Micau_4939
   00650 Butanoate metabolism
    Micau_4939
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Micau_4939
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Micau_4939
   00622 Xylene degradation
    Micau_4939
   00621 Dioxin degradation
    Micau_4939
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Micau_4939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADL48448
JGI: Micau_4939
UniProt: D9TAJ2
Position
complement(5570058..5570993)
Genome map
AA seq 311 aa AA seqDB search
MTVGVAVLGSGNIGTDLMIKVLRLSESLRMVAMAGIDPASDGLARARRLGVTTTAEGVDG
LVALPEFADVQLVFDATSAGAHKRHDEVLRAHGRTVVDLTPAAIGPYVVPPVNLDEHLGE
PNVNMVTCGGQATVPIVHAVGRVTPVAYGEIVASIASKSAGPGTRANIDEFTETTARAIE
VVGGAERGKAIIVLNPADPPLLMRDTVYCLCPDADADRGAIAASVADMVKAVQEYVPGYR
LKQDVQFDAVDTYAPVLGRHFTGLQVSVFLEVSGAGHYLPAYAGNLDIMTSAALRTAERL
VALRSPEVSAR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcggagtggcagtgctcgggtcgggcaacatcggcaccgacctgatgatcaag
gtgttgcggctcagtgagagcctgcgcatggtggcgatggccggcatcgacccggcctcg
gacggtctggcccgggcccgccggctcggcgtgaccaccaccgccgagggcgtcgacggc
ctcgtggcgctgcccgagttcgcggacgtccagctcgtcttcgacgccacctcggccggc
gcgcacaagcgtcacgacgaggtgctgcgggcgcacggccgtaccgtcgtcgacctgacg
cccgcggccatcggcccgtacgtggtgccgccggtgaacctcgacgagcacctgggcgag
ccgaacgtcaacatggtgacctgcggcggccaggccacagtgccgatcgtgcacgcggtc
ggccgggtcacccccgtcgcgtacggcgagatcgtcgcctcgatcgcctcgaagtcggcc
gggcccggcacccgggccaacatcgacgagttcaccgagaccaccgcccgcgccatcgag
gtggtcggcggcgccgagcgcggcaaggccatcatcgtgctgaacccggccgacccgccg
ctgctcatgcgtgacacggtctactgcctgtgcccggacgccgacgccgaccggggcgcg
atcgccgcctcggtggccgacatggtgaaggccgtgcaggagtacgtgcccggctaccgg
ctcaagcaggacgtgcagttcgacgccgtggacacgtacgcgccggtgctgggccggcac
ttcaccggcctccaggtgtcggtgttcctggaggtctccggcgccgggcactacctgccc
gcgtacgccggcaacctggacatcatgacgtcggccgcgctgcgtaccgcggagcggctg
gtggcgctgcgttccccggaggtgagtgcccgatga

DBGET integrated database retrieval system