KEGG   Micromonospora aurantiaca: Micau_5080Help
Entry
Micau_5080        CDS       T01296                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00010  Glycolysis / Gluconeogenesis
mau00020  Citrate cycle (TCA cycle)
mau00620  Pyruvate metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
Module
mau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_5080
   00020 Citrate cycle (TCA cycle)
    Micau_5080
   00620 Pyruvate metabolism
    Micau_5080
Enzymes [BR:mau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Micau_5080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADL48588
JGI: Micau_5080
UniProt: D9TBP1
Position
5711545..5712822
Genome map
AA seq 425 aa AA seqDB search
MSVQQFRLPDVGEGLTEAEIVTWRVAPGDPVGLNDVIVDIETAKAVVELPSPYAGVVDRL
LAAEGQTVEVGSPIIAIRTGDDSDAPDAAPAAASPPAEEPAEERTAVLVGYGVSAQARTR
RPRRATPSVRPADTSRPAHTSRPPVLTKPPLRKLAKDLGVELADVRGSGPDGRITRQDLL
DHTTGPAPVADHRRDERLPVRGVRKATAAAMVASAFTAPHVTEFLTVDMTGTVEFVDRLK
QDPAFQGVKVSPLLVASLAVLDAVRRYPDVNARWDEENQEIVRFADVNLGIAAATPRGLL
VPNVKAAQNLPVRDLAVALNELASTAREGRTRPADLAGGTITITNIGVFGVDAGTPILNP
GEAAILCLGALRRMPWVVDEQVVPRWTVQLSLSFDHRLVDGELGSRVLAHVGRFLEDPLW
GLALR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttcagcagttccgtctgcccgacgtcggcgagggcctcaccgaggccgagatc
gtcacctggcgggtcgcaccgggcgatccggtcggcctcaacgacgtcatcgtggacatc
gagaccgccaaggccgtggtcgagctgcccagcccgtacgccggagtggtggaccgcctc
ctggccgcggaggggcagaccgtcgaggtcggctcgccgatcatcgcgatccggaccggg
gacgactcggacgcgccggatgccgcgccggccgccgcatcgccgccggccgaggagccc
gccgaggagcgcacggcggtgctcgtcggctacggggtgtccgcccaggcgcggacgcgg
cggccccgtcgcgccacaccgtccgtccggccggccgacacctcccgcccggcgcacacg
tcccggccgccggtgctcaccaagccgccgctgcgcaagctcgccaaggacctcggcgtg
gagctggcggacgtccgcggcagcggccccgacggccggatcacgcgccaggacctgctc
gaccacaccaccggcccggcgccggtggccgaccaccggcgggacgagcgcctgcccgtg
cgcggggtgcgcaaggcgacagccgccgcgatggtcgccagcgcgttcaccgcgccgcac
gtcaccgagttcctcaccgtcgacatgacaggcaccgtcgagttcgtggaccggctgaag
caggacccggcgttccagggcgtgaaggtcagcccgctgctcgtggcgtcgctcgcggtg
ctggacgcggtccgccggtatccggacgtcaacgcccggtgggacgaggagaaccaggag
atcgtccggttcgccgacgtcaacctgggcatcgccgccgcgacgccgcgcggcctgctg
gtgccgaacgtcaaggccgcgcagaaccttccggtacgcgatctcgcggtcgccctgaac
gagctggcgagcaccgcgcgggagggccgaacccgtcccgccgacctggccggcgggacg
atcaccatcaccaacatcggcgtgttcggcgtggacgccggcactccgatcctcaacccc
ggcgaggcggcgatcctctgcctcggcgcgctgcgccggatgccgtgggtggtcgacgag
caggtcgtcccccggtggacggtgcagttgtcgctgtcgttcgaccaccggctggtggac
ggggaactgggcagccgggtgctcgcccacgtcggccggttcctggaggacccgctgtgg
ggtctggccctgcgctga

DBGET integrated database retrieval system