KEGG   Micromonospora aurantiaca: Micau_5157Help
Entry
Micau_5157        CDS       T01296                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mau01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mau00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mau00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5801934..5802983)
Genome map
AA seq 349 aa AA seqDB search
MWRGLIEAYRDRLPVTGATPVVTLHEGNTPLLPAPVLSARVGADVWLKVEGANPTGSFKD
RGMTVAVSKAVEAGDKAIICASTGNTSASAAAYAARAGITCAVLVPQGKIALGKLAQALV
HGAKLLQVQGNFDDCLGLAGKLAQDYPVALVNSVNIDRLHGQKTAAFEIVEALGDAPDIH
CLPVGNAGNITAYWMGYSEDLRDGNATKAPRMYGFQAAGAAPIVTGQVVPEPSTIATAIR
IGNPASWTKAIDARDASDGLISAVTDREILSAYRLLAREVGAFVELGSAASVAGLLQQAE
AGRVPAGSRVVCTVTGHGLKDPEWAISTAPAPVTIANDALAAARSLDLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggactgatcgaggcgtaccgggatcggctgccggtcaccggggcgactccc
gtcgtcaccctgcacgagggcaacacgccgctgctgccggcaccggtgctctccgcccgg
gtcggcgcggacgtgtggctcaaggtcgagggcgccaacccgaccggctcgttcaaggac
cgcggcatgactgtcgcggtctccaaggccgtcgaggccggtgacaaggcgatcatctgc
gcctccaccggcaacaccagcgcctccgccgccgcgtacgcggcccgcgccgggatcacc
tgcgcggttctggtgccgcagggcaagatcgcgctgggcaagctggcccaggcgctcgtg
cacggcgcgaagctgctccaggtgcagggcaacttcgacgactgcctcgggctcgccggc
aagctcgcccaggactacccggtcgcgctggtcaactccgtcaacatcgaccggctgcac
ggccagaagacagccgccttcgagatcgtcgaggcgctcggcgacgcgcccgacatccac
tgcctgccggtcggcaacgccggcaacatcaccgcgtactggatgggctactccgaggac
ctgcgcgacggcaacgccacgaaggccccccggatgtacggcttccaggcggccggcgcc
gctcccatcgtcaccggtcaggtggtgccggagccgtcgacgatcgccaccgccatccgg
atcggcaacccggcgagctggacgaaggccatcgacgcgcgggacgcctccgacggtctg
atctcggcggtcaccgaccgggagatcctgtcggcgtaccggctgctggcccgcgaggtg
ggcgccttcgtcgagctgggcagcgcggccagcgtcgccggtctgctccagcaggccgag
gccgggcgggtgccggccgggtcgcgggtggtctgcacggtcaccgggcacggcctgaag
gacccggagtgggccatctccaccgcgccggcgccggtgaccatcgccaacgacgcgctg
gccgccgcccgctcgctagacctggtctga

DBGET integrated database retrieval system