KEGG   Micromonospora aurantiaca: Micau_5271Help
Entry
Micau_5271        CDS       T01296                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Micau_5271
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Micau_5271
Exosome [BR:mau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Micau_5271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5921146..5922660
Genome map
AA seq 504 aa AA seqDB search
MDARGGYGAAVTAEFVAAIDQGTTSSRCIVFDRAGEIVAVAQREHRQIFPRPGWVEHDAE
EIWTNVEHVVREALASADIGTESLAAVGITNQRETTVMWDRETGRPVANAIVWQDTRTGP
LLRELTEAYDEERLRTRTGLTPATYFAGPKLRWLLDNVDGLRERAERGEVLFGTMDSWLI
WKLTGRHVTDVTNASRTMLMDLETLDWAPELLDALRVPAAVLPEIRSSAEVYGTAQGVLA
GVPVASALGDQQAALFGQTCFQPGEAKCTYGTGSFLLLNTGASPVPSRHGLLTTVAYRIE
GQPAVYALEGAIAVTGSLVQWLRDNLGLISSAPQVEELARTVDDNGGCYVVPAFSGLFAP
HWRSDARGVIAGLTGYITKGHLARAVLEASAFQTREVVDAMNADSDVALRRLRVDGGMTG
NELLMQFLADVLDVPVVRSRITETTCLGAAYAAGLAVGFWPDLATLREKWRSDAQWESTM
DPAHREQEMRQWRKAVRRTLDWVD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggacgctcgcggcgggtacggtgctgccgtgaccgcagagttcgtcgccgccatcgac
cagggcaccacgtcctcgcgctgcatcgtcttcgaccgggccggtgagatcgtcgccgtg
gcccagcgcgagcaccggcagatcttcccccggcccggctgggtggagcacgacgccgag
gagatctggacgaacgtcgagcacgtggtgcgcgaggcgctggccagcgccgacatcggc
accgagtcgctggccgcggtgggcatcaccaaccagcgcgagaccactgtgatgtgggac
cgggagaccggccgtccggtggcgaacgccatcgtctggcaggacacccgcaccggtccg
ctgctgcgggagctgaccgaggcgtacgacgaggagcggctgcggacccgcaccggcctg
accccggccacctacttcgccggcccgaagctgcgctggctgctcgacaacgtcgacggg
ctgcgcgagcgggccgagcgcggcgaggtgctgttcggcaccatggacagctggctgatc
tggaagctgaccggccggcacgtcaccgacgtgacgaacgccagccgcaccatgctgatg
gacctggagacgctcgactgggccccggagctgctcgacgcgctgcgcgtcccggccgcc
gtgctgccggagatccgcagctcggccgaggtgtacggcaccgcccagggggtgctggcc
ggggtgccggtggcgagcgcgctcggcgaccagcaggcggccctgttcgggcagacctgt
ttccagcccggcgaggccaagtgcacctacggcaccggcagcttcctgctgctcaacacc
ggcgccagcccggtgccgtcgcggcacggcctgctcaccaccgtggcgtaccggatcgag
ggccagcccgccgtgtacgcgctggagggtgccatcgcggtcaccggctcgctcgtgcag
tggctgcgggacaacctcggcctgatctcctccgcaccgcaggtcgaggagctggcccgc
accgtcgacgacaacggcggctgctacgtggtgccggccttctccggcctgttcgccccg
cactggcgcagcgacgcccggggcgtgatcgccgggctgaccggctacatcaccaaggga
cacctggcccgcgcggtgctggaggcgtcggccttccagacccgggaggtggtggacgcg
atgaacgccgactccgacgtggcgctgcgccggctgcgggtcgacggcgggatgaccggc
aacgagctgctgatgcagttcctcgccgatgtgctcgacgtgccggtcgtgcggtcccgg
atcaccgagacgacctgcctcggcgccgcgtacgccgccggcctggccgtcgggttctgg
ccggacctggccacgctgcgcgagaagtggcgatcggacgcgcagtgggagtcgaccatg
gacccggcgcaccgggagcaggagatgcgccagtggcgcaaggcggtgcggcgcacgctc
gactgggtcgactga

DBGET integrated database retrieval system