KEGG   Micromonospora aurantiaca: Micau_5419Help
Entry
Micau_5419        CDS       T01296                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
mau  Micromonospora aurantiaca
Pathway
mau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Micau_5419
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Micau_5419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO Pyr_redox_2 FAD_binding_2 NAD_binding_8 OpcA_G6PD_assem FAD_binding_3 HI0933_like GIDA Fer4
Motif
Other DBs
NCBI-ProteinID: ADL48925
JGI: Micau_5419
UniProt: D9TE42
Position
complement(6080960..6082642)
Genome map
AA seq 560 aa AA seqDB search
MRYDVLVIGSGFGGSVTALRLAEKGYTVGVLEAGRRFADDEFPRTSWRARRFLWAPRLGC
FGLQRITLLRSADRKAGGGVLVLSGAGVGGGSLVYANTLYEPLDAFYADPQWRDITDWRD
ELARHYDQAKRMLGVTTYPIDTRADQAVRAVAERMGVAHTYHPTPVGVHIGRPGERVADP
YFGGAGPDRTGCSHCGSCMTGCRHGAKNTLVKNYLWLAERLGVQVHPLTTVTAVRPDPAG
GYAVHTERTGAWLRKRREVIHADQVVFAAGALGTQRLLHEMKSTGALPALSPRLGELTRT
NSEAILGASVAPGAARKRGLDFTEGVAITSSFHPDAQTHIEPVRYGKGSNAMGLLQSLLV
DGGPRRVRRWLGSIVRQPVLAARMLSVRRWSERTVIALVMQSVDNSLTTRYRKGRLVSGP
GHGAPNPTWIPAGNTAARLLAEEIGGTPGGAVTEPFNIPVTAHILGGAVIGATPDEGVID
PWHRVYGHPGLHVVDGAAVSANLGVNPSLTITAQAERAMSYWPNKGEADPRPALGTAYTR
VEPVPPRRPAVPAHAPAALR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgacgtgctcgtcatcggttcgggcttcggcggcagcgtcaccgcgctccgg
ctggccgagaagggctacacggtgggcgtcctggaggcggggcggcgcttcgccgacgac
gagttcccgcgtacgtcctggcgggcgcgacggttcctctgggcgccccggctcggctgc
ttcgggctccagcggatcacgctgctgcgctcggccgaccgcaaggccggaggcggcgtg
ctggtgctctccggcgccggggtcggcggtgggtcactcgtctacgcgaacacgctctac
gagccgctcgacgcgttctacgccgacccgcagtggcgggacatcaccgactggcgcgac
gagctggcccgccactacgaccaggcgaagcggatgctcggcgtcaccacgtacccgatc
gacacccgcgcggaccaggccgtccgcgcggtggccgagcggatgggggtggcgcacacc
taccacccgacgccggtcggggtgcacatcgggcgccccggcgagcgggtggccgacccc
tacttcggcggggccgggccggaccgcaccgggtgcagccactgcgggtcgtgcatgacc
ggctgccggcacggcgccaagaacacgctcgtgaagaactacctctggctggccgagcgc
ctcggtgtgcaggtgcacccgctgaccacggtcaccgccgtacgcccggacccggccggc
ggctacgcggtgcacaccgagcgcaccggcgcctggctgcgcaagcggcgcgaggtgatc
cacgccgaccaggtggtgttcgcggccggcgcgctcggcacccagcggctgctgcacgag
atgaagtcgacgggtgccctgccggcgctctcgccccggctgggcgagctgacccgcacc
aactccgaggccatcctcggcgcctcggtggcgcccggcgcggcccggaagcgcggcctc
gacttcaccgagggggtggcgatcaccagctcgttccaccccgacgcgcagacccacatc
gagccggtccgctacggcaagggctccaacgcgatgggcctgctccagtcgctgctcgtc
gacggcggcccccgccgggtccggcgctggctcgggagcatcgtccggcagcccgtgctg
gccgcgcggatgctgtcggtacgccgctggtccgagcgcaccgtgatcgcgctcgtcatg
cagtcggtcgacaactcgctgaccacccgctaccgcaaggggcggctggtctccggcccc
ggccacggcgcgcccaacccgacctggatcccggccggcaacacggcggcccggctgctc
gccgaggagatcggcggcacccccggcggggcggtcaccgagccgttcaacatcccggtg
acggcgcacatcctcggcggcgcggtcatcggcgccaccccggacgagggtgtgatcgac
ccctggcaccgggtgtacggccacccggggctgcacgtggtggacggcgcggcggtctcg
gcgaacctgggcgtcaacccgtcgctgaccatcaccgcgcaggccgagcgggccatgtcg
tactggccgaacaagggcgaggcggacccgcgcccggcgctcggcacggcgtacacccgg
gtcgagccggtcccgccgcggcggccggccgtccccgcgcacgcccccgccgccctgcgg
tga

DBGET integrated database retrieval system