KEGG   Micromonospora aurantiaca: Micau_5470Help
Entry
Micau_5470        CDS       T01296                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00860  Porphyrin and chlorophyll metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
Module
mau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Micau_5470
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Micau_5470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADL48976
JGI: Micau_5470
UniProt: D9TF03
Position
6137624..6138712
Genome map
AA seq 362 aa AA seqDB search
MRDELAGFTIGVTADRRRDELAALLQRRGARVVLAPALRIVPLADDTDLREATRACLEHP
PDVLMANTGIGMRGWLEAAEGWGLAEPLRTTLARAYVVSRGPKATGAIRAAGLREHWSPD
SESCDEVVEHLVRRGVAGQVVAMQLHGERQPECADALVAAGATVIEVPVYRWAPPADPAP
LHRLIDLVAGRLVDAVTFTSAPAAEALLRAAGDRTETVLEALRGDVLAGCVGTVTAEPLV
RRGVPVSAPSRARLGALVRTIVEELPRRTVSVKAAGHVLTLRGHAAVVDGELRQLAPAPM
AVLRALAASPGKVLSRTALLRTLPRGADEHAVEMAVARLRAGLTAPRVVQTVVKRGYRLR
VD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacgagctggccggcttcaccatcggggtcaccgccgaccggcggcgcgacgaa
ctggccgcgctgctccagcggcgcggtgcgcgggtggtgctcgccccggcgctgcggatc
gtcccgctggccgacgacaccgacctgcgtgaggccacccgggcctgcctggaacacccg
ccggacgtgctgatggccaacaccggcatcggcatgcggggctggctggaggcggccgag
ggctgggggctggccgagccgctgcgcaccacgctcgcccgcgcgtacgtggtgtcccgc
ggtccgaaggcgaccggcgcgatccgcgccgccgggctgcgcgagcactggtccccggat
tcggagagctgcgacgaggtggtcgagcacctggtccggcgcggggtggccggccaggtc
gtggcgatgcaactgcacggcgagcggcagcccgagtgcgccgacgcgctggtggcggcc
ggcgccacggtgatcgaggtgccggtgtaccggtgggcgccgccggccgacccggcgccg
ctgcaccggctcatcgacctggtggccgggcgtctcgtcgacgcggtcacgttcacctcg
gccccggcggccgaggcgctgctgcgcgcggccggggaccgtaccgagacggtgctggag
gcgctgcgcggcgacgtgctggccgggtgcgtcggcaccgtcaccgccgagccgctggtg
cggcgcggggtgccggtgagcgcgccgagccgggcccggcttggcgccctggtccgcacc
atcgtcgaggagctgccccggcgcacggtctcggtgaaggcggccgggcacgtgctgacg
ctgcgcgggcacgccgcggtggtcgacggggagctgcgccagctggcgccggcgccgatg
gcggtgctgcgggcgctcgccgcgtcgccggggaaggtgctctcccgcaccgcgctgctg
cggacgctgccacgcggcgccgacgagcacgcggtggagatggcggtcgcccgcctgcgg
gcggggctgacggcgccccgcgtggtgcagacggtggtcaagcgggggtaccgcctgcgg
gtcgactga

DBGET integrated database retrieval system