KEGG   Micromonospora aurantiaca: Micau_5470Help
Entry
Micau_5470        CDS       T01296                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mau  Micromonospora aurantiaca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Micau_5470
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Micau_5470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6137624..6138712
Genome map
AA seq 362 aa AA seqDB search
MRDELAGFTIGVTADRRRDELAALLQRRGARVVLAPALRIVPLADDTDLREATRACLEHP
PDVLMANTGIGMRGWLEAAEGWGLAEPLRTTLARAYVVSRGPKATGAIRAAGLREHWSPD
SESCDEVVEHLVRRGVAGQVVAMQLHGERQPECADALVAAGATVIEVPVYRWAPPADPAP
LHRLIDLVAGRLVDAVTFTSAPAAEALLRAAGDRTETVLEALRGDVLAGCVGTVTAEPLV
RRGVPVSAPSRARLGALVRTIVEELPRRTVSVKAAGHVLTLRGHAAVVDGELRQLAPAPM
AVLRALAASPGKVLSRTALLRTLPRGADEHAVEMAVARLRAGLTAPRVVQTVVKRGYRLR
VD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacgagctggccggcttcaccatcggggtcaccgccgaccggcggcgcgacgaa
ctggccgcgctgctccagcggcgcggtgcgcgggtggtgctcgccccggcgctgcggatc
gtcccgctggccgacgacaccgacctgcgtgaggccacccgggcctgcctggaacacccg
ccggacgtgctgatggccaacaccggcatcggcatgcggggctggctggaggcggccgag
ggctgggggctggccgagccgctgcgcaccacgctcgcccgcgcgtacgtggtgtcccgc
ggtccgaaggcgaccggcgcgatccgcgccgccgggctgcgcgagcactggtccccggat
tcggagagctgcgacgaggtggtcgagcacctggtccggcgcggggtggccggccaggtc
gtggcgatgcaactgcacggcgagcggcagcccgagtgcgccgacgcgctggtggcggcc
ggcgccacggtgatcgaggtgccggtgtaccggtgggcgccgccggccgacccggcgccg
ctgcaccggctcatcgacctggtggccgggcgtctcgtcgacgcggtcacgttcacctcg
gccccggcggccgaggcgctgctgcgcgcggccggggaccgtaccgagacggtgctggag
gcgctgcgcggcgacgtgctggccgggtgcgtcggcaccgtcaccgccgagccgctggtg
cggcgcggggtgccggtgagcgcgccgagccgggcccggcttggcgccctggtccgcacc
atcgtcgaggagctgccccggcgcacggtctcggtgaaggcggccgggcacgtgctgacg
ctgcgcgggcacgccgcggtggtcgacggggagctgcgccagctggcgccggcgccgatg
gcggtgctgcgggcgctcgccgcgtcgccggggaaggtgctctcccgcaccgcgctgctg
cggacgctgccacgcggcgccgacgagcacgcggtggagatggcggtcgcccgcctgcgg
gcggggctgacggcgccccgcgtggtgcagacggtggtcaagcgggggtaccgcctgcgg
gtcgactga

DBGET integrated database retrieval system