KEGG   Micromonospora aurantiaca: Micau_5640Help
Entry
Micau_5640        CDS       T01296                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00860  Porphyrin and chlorophyll metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Micau_5640
Enzymes [BR:mau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Micau_5640
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Micau_5640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase B12-binding
Motif
Other DBs
NCBI-ProteinID: ADL49146
JGI: Micau_5640
UniProt: D9SYG5
Position
complement(6308993..6310573)
Genome map
AA seq 526 aa AA seqDB search
MTRTRKPVGQIAFVGAGPGDPGLLTRRALDALVEADQVVYDRGVPESLLAHVRAQARPGA
EFSPAEGVPGDVAKVLISAARSGQNAVHLVAGDPFGHDSVVKEVQAVARTAAHFEVVPGV
GQAEGVATYAGVPLPGVRTAADVEDVTALDFEALATAVGRGSLALAVDAGDLAAVRDGLL
AAGVDGTTAVGVTGDGTGETQYTTTSTVDSFVAAALGFTGRVVLTVGAAVTDRDKLSWWE
NRPLYGWKVLVPRTKEQAGVMSARLRAYGAIPCEVPTIAVEPPRTPAQMERAVKGLVDGR
YAWVIFTSVNAVRAVWEKFAEHGLDARHFGGVKIACIGDATAEAVRAFGIQPELIPSGEQ
SSEGLLAEFSPHDEILDPVGRVLLPRADIATETLAAGLTERGWEVDDVTAYRTVRAAPPP
AEIRDAIKSGGFDAVLFTSSSTVRNLVGIAGKPHARTVVAVIGPKTAETATEFGLRVDVQ
PPHASVPDLVEALAAYAVELREKLAAMPAKQRRGSKVQGPTALRFR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacccgtaagcccgtaggccagatcgcattcgtcggggccggtcccggcgac
ccgggcctgctgacccgccgggcgctggacgccctggtcgaggccgaccaggtggtctac
gaccggggcgtacccgagtcgctcctggcgcacgtccgcgcccaggcccggccgggcgcc
gagttcagccccgccgagggcgtgccgggggacgtggcgaaggtgctgatctccgcggcc
cggtccgggcagaacgccgtgcacctggtcgccggtgacccgttcggccacgactcggtg
gtcaaggaggtgcaggcggtcgcgcgtaccgccgcgcacttcgaggtggtcccgggcgtc
ggccaggccgagggcgtggccacgtacgcgggtgtcccgctgccgggcgtacgcaccgcc
gccgacgtcgaggacgtcaccgcgctggacttcgaggcgctcgccaccgccgtcgggcgg
ggttcgctggcgctcgccgtggacgccggtgacctggccgccgtccgggacggcctgctg
gccgccggggtcgacggcaccacagcggtcggggtgaccggtgacggcaccggcgagacg
cagtacaccaccacgtcgacagtcgactccttcgtcgcggcggcgctcggcttcaccggc
cgggtggtgctcaccgtcggcgcggccgtcaccgaccgcgacaagctgagctggtgggag
aaccgcccgctgtacggctggaaggtgctggtgccccgcaccaaggagcaggccggcgtg
atgagtgcgcggctgcgcgcgtacggggcgatcccgtgcgaggtgccgaccatcgcggtc
gagccgccgcgtaccccggcgcagatggagcgggccgtgaagggcctggtcgacggccgg
tacgcctgggtcatcttcacctcggtgaacgcggtccgggcggtgtgggagaagttcgcc
gagcacggcctcgacgcccgccacttcggtggcgtgaagatcgcctgcatcggtgacgcc
accgccgaggcggtccgtgccttcggcatccagcccgagctgatcccctccggggagcag
tcctccgagggcctgctggccgagttctcgccgcacgacgagatcctcgacccggtcggc
cgggtgctgctgccgcgcgccgacatcgccaccgagaccctggccgccggcctgaccgag
cgcggctgggaggtcgacgacgtgaccgcgtaccggaccgtgcgcgcggcgccgccgccc
gccgagatccgcgacgcgatcaagtccggcgggttcgacgcggtgctgttcacctcgtcg
tccacagtgcggaacctcgtcggtatcgccgggaagccgcacgcgcggaccgttgttgca
gtgatcgggcccaagacggcggagaccgccaccgagttcggcctgcgcgtcgacgtgcag
ccgccgcacgcctcggtgcccgacctggtggaggcgctcgccgcctacgccgtcgagctg
cgggagaagctcgccgccatgccggcgaagcagcgccggggctcgaaggtgcagggcccg
accgccctgcggttccgctga

DBGET integrated database retrieval system