KEGG   Micromonospora aurantiaca: Micau_5675Help
Entry
Micau_5675        CDS       T01296                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00010  Glycolysis / Gluconeogenesis
mau00260  Glycine, serine and threonine metabolism
mau00680  Methane metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
mau01230  Biosynthesis of amino acids
Module
mau_M00002  Glycolysis, core module involving three-carbon compounds
mau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_5675
  Energy metabolism
   00680 Methane metabolism
    Micau_5675
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_5675
Enzymes [BR:mau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Micau_5675
Membrane trafficking [BR:mau04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Micau_5675
Exosome [BR:mau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Micau_5675
  Exosomal proteins of melanoma cells
   Micau_5675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADL49180
JGI: Micau_5675
UniProt: D9SYJ9
Position
complement(6343246..6344013)
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTAKGETEARRGGELLREHDLLPDV
VHTSLMRRAIRTAELALNAADRHWIAVRRSWRLNERHYGALQGKDKKQTLDEYGEEQFML
WRRSYDTPPPPIDDADEWSQVGDPRYALLPTELMPRTECLKDVVERMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRYDLDADLRPQVLGGTYLDP
DAAKAAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgagcgaggggcccaccgtcgggacgctggtcctgctgcggcacggcgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtcgacctgaccgccaagggg
gagaccgaggcgcggcgcggcggcgagctgctgcgcgagcacgacctgctgccggacgtg
gtgcacacgagcctgatgcgccgagccatccgcaccgccgagctggcgctgaacgccgcc
gaccggcactggatcgcggtacgccggtcgtggcggctcaacgaacgccactacggcgcc
ctgcagggcaaggacaagaagcagaccctcgacgagtacggcgaggagcagttcatgctc
tggcgccgctcgtacgacacgccgccgccgccgatcgacgacgcggacgagtggtcgcag
gtcggcgacccccggtacgcgctgctgccgaccgagctgatgccgcgcaccgagtgcctg
aaggacgtcgtcgaacggatgctgccctactggtacgactcgatcgtgccggacatcctg
gccggccggacggtgctggtggccgcgcacggcaactcgctgcgcgccctggtcaagcac
ctcgaccagatctccgacgaggcgatcgccaagctgaacatccccaccggcatcccgctg
cgctacgacctggacgccgacctgcgcccgcaggtgctcggcgggacgtacctggacccg
gacgcggcgaaggctgccgccgccgcggtcgccaaccagggccgctga

DBGET integrated database retrieval system