KEGG   Micromonospora aurantiaca: Micau_5756Help
Entry
Micau_5756        CDS       T01296                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Micau_5756
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_5756
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Micau_5756
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Micau_5756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6423985..6425274)
Genome map
AA seq 429 aa AA seqDB search
MTSTLPVATGIDTTLSPARALVCRACSARYPLAAQHACYECFGPLEVDYDTAALATVTRE
QIEAGPDNIWRYAALLPAGQDPATRVTLDPGLTPLVAAPHLAAELGLTAPLWVKDDSANP
THSFKDRVVSVALTAARALGFARYACASTGNLANSVAAHAARAGVPSIVFIPGDLEQGKV
VTTAVYGGDLVAIDGSYDDVNRLCGELVETDEFEDTAFVNVNVRPYYAEGSKTLGYEVAE
QLGWRIPAQVVIPMASGELLTKIDKAFAELVEIGLVEAPAGGWKVFGAQSAGCNPIATAL
HGDTDTIVPVKPAGIAKSLNIGDPAAGLYALEAVRRTGGWMDYADDDEIRAGIRLLARTT
GVFAETAGGVTVAVLRKLVESGRLDPAAETVVFNTGEGLKTLDAVATQVGPTHRIKPSLR
AARDAGLLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgacgcttcccgtcgccaccggtatcgacaccaccctcagcccggcccgcgcc
ctggtctgccgtgcctgttcggcgcggtacccgctcgccgcgcagcacgcctgctacgag
tgtttcgggccgctggaggtcgactacgacaccgccgcgctcgccaccgtcacccgtgag
cagatcgaggccggtccggacaacatctggcggtacgcggcgctgctgccggccggtcag
gacccggccacccgggtcacgctcgacccggggctgaccccgctcgtcgccgccccgcac
ctcgcggccgagctggggctcaccgcgccgctctgggtcaaggacgacagcgcgaacccc
acccactcgttcaaggaccgggtcgtctcggtggcgctcaccgcggcccgcgcgctcggc
ttcgcccgctacgcctgcgcctccaccggcaacctcgccaactccgtcgccgcgcacgcg
gcccgggccggcgtgccgtcgatcgtcttcatccccggcgacctggagcagggcaaggtc
gtcaccaccgctgtgtacggcggcgacctggtcgccatcgacggctcgtacgacgacgtg
aaccggctctgcggcgagctggtggagaccgacgagttcgaggacaccgcgttcgtcaac
gtgaacgtccggccctactacgcggagggctccaagacgctcggctacgaggtggccgag
cagctcggctggcggatcccggcccaggtggtcatcccgatggccagcggcgagctgctc
accaagatcgacaaggcgttcgccgagctggtcgagatcgggctggtcgaggcaccggcc
ggcggctggaaggtgttcggcgcgcagtcggccggctgcaacccgatcgccaccgcgctg
cacggcgacaccgacacgatcgtgccggtcaagccggccggcatcgccaagtcgctgaac
atcggcgacccggcggccgggctgtacgcgctggaagcggtgcggcgtaccggcggctgg
atggactacgccgacgacgacgagatccgcgcgggcatccggctgctcgcccgtaccaca
ggggtgttcgccgagacggccggcggcgtgacggtcgcggtgctgcgcaagctggtcgag
tcgggccggctcgacccggccgccgagacggtggtgttcaacaccggcgagggcctgaag
acgctcgacgcggtggccacccaggtcggccccacccaccgcatcaagcccagcctccgc
gccgcccgcgacgccggcctcctggcctga

DBGET integrated database retrieval system