KEGG   Micromonospora aurantiaca: Micau_5779Help
Entry
Micau_5779        CDS       T01296                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Micau_5779
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_5779
   00052 Galactose metabolism
    Micau_5779
   00500 Starch and sucrose metabolism
    Micau_5779
   00520 Amino sugar and nucleotide sugar metabolism
    Micau_5779
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Micau_5779
   00524 Butirosin and neomycin biosynthesis
    Micau_5779
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Micau_5779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6447824..6448756
Genome map
AA seq 310 aa AA seqDB search
MSAGDEVVVALDVGGTGMKCALVRPDGTTVHTERHATEAQRGPEAVVGTILDVAEGLAGK
ARADGRTPVACGIAVPGVVDEARGVAVWSANVGFRDVPLRELAGTRLGLPAALGHDVRAG
GLAEARLGAGRDGGHVLFVAIGTGIAAAHVVDGSAATGAHGAAGEIGHILVRPGGPRCGC
GRTGCLEAVSSASAIGRRYAELSGAPTTAAQVADRAAAGEPLAVEVWQEAVEALADGLAT
GQALYDVSTVVLGGGLAQAGPRLFDPLRTALRERLTFHREPRLVAADLGDEAGCLGAALL
ALDTLAKESR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaggcgacgaggtcgtcgtcgcgctggacgtgggcggcaccgggatgaagtgc
gccctggtccggccggacggcacgactgtgcacaccgaacggcacgccaccgaagcgcag
cggggcccggaggcggtggtcggcaccatcctcgacgtggccgaaggactcgccggcaag
gcccgcgccgacggccgtaccccggtggcctgcggcatcgccgtacccggagtggtcgac
gaggcgcgcggcgtggcggtctggtcggcgaacgtgggcttccgggacgtacccctgcgg
gagctggcgggcacgcggctgggactgccggcggcgctcggccacgacgtgcgggcgggc
ggtctggccgaggcccggctcggcgccgggcgggacggcgggcatgtgctgttcgtcgcg
atcggcaccggcatcgccgccgcccacgtggtcgacgggtcggccgccaccggcgcgcac
ggcgccgccggggagatcggccacatcctggtacgccccggcggcccgcgctgcggatgc
gggcggaccggctgcctggaggcggtgtcgtcggcctcggcgatcggacgccggtacgcc
gagctgtcaggtgcgcccaccaccgccgcccaggtggccgaccgggcggccgccggtgag
ccgctcgccgtggaggtgtggcaggaggcggtagaggccctcgccgacggactcgccacc
gggcaggcgctctacgatgtctcgacagtggtgctcggcggcgggctggcccaggccggt
ccccggctgttcgacccgctgcggacggcgttgcgcgagcggctgacgttccaccgcgag
ccgcgcctggtcgcggccgacctcggtgacgaggccggctgcctgggcgccgccctgctg
gccctggacaccctggcgaaggagagtcgatga

DBGET integrated database retrieval system