KEGG   Micromonospora aurantiaca: Micau_5799Help
Entry
Micau_5799        CDS       T01296                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mau  Micromonospora aurantiaca
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mau00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6468491..6470371
Genome map
AA seq 626 aa AA seqDB search
MQLMVAWAATGALPQPRLDAAVARFDKAVADLVPESWHRRRFGGTDWGVLVLHPADPGGY
RWPPVATDGPVTAVSVGIPVGADGDDPVTLANRLLTGEDVHRDVVPPFALLALDRDRLAL
QQDWLGMARVFTGAADGITAWCTRPGLLADFLHGEARPDPAGWTSYLLTGHFGGDLSPLA
GIRLLQPGERVTGRRRADGGWQLTTEIRYAADDVVRSGLADRDRPTDERLDLAADALTRS
VAGLHRLHDGEVTLGLSGGKDSRLIAATLVAADRTPDLVTNDDTPAEGDVARELVRLLRD
RRGLELPHRLTPAAPPETVLGTGLRDRARRLAALHDHQFPSTYLTRPAARTRLPDEVRPP
SLTGAAGELVVGFWYPRPDADPAPTPEQAAMSKLLAAVPRGTTTPEALAAERDRVTALTA
HARELGLRDEHLIDYVYLVERMRRWCTAAYTTGMVTPFLAPGFVAASFAFTAAEKRARLP
HTALIARLVPEWADVPFVSSATGPSRATRIWEGDGVAAVADLLDTVHGPLTELIRRPAVE
RELRTAARGGRPDPRVLAQFTALAVASERLEPDFTGPSTGATYERVTAPPLPRTPPESRL
AGLRWLRRTRLGDRLWVMVRRRVRGR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgatggtggcctgggccgcgaccggggcgttgccacaaccgcgcctcgatgcc
gccgtggcccggttcgacaaggccgtggccgacctcgtacccgaaagctggcaccgccgg
cgcttcggcggcaccgactggggcgtgctggtgctgcacccggccgatccgggcggatac
cggtggccgcccgtcgccaccgacggccccgtcaccgccgtctccgtgggcatcccggta
ggggccgacggcgacgacccggtgacgctcgccaaccgcctgctcaccggcgaggacgtg
caccgggacgtcgtaccgccgttcgcgctgctcgcactcgaccgcgaccgtctcgccctg
caacaggactggctgggcatggcccgggtgttcaccggcgcggccgacgggatcaccgcc
tggtgcacccggcccggtctgctcgccgacttcctgcacggcgaggcccgccccgacccg
gccggctggacgtcgtacctgctcaccggccatttcggcggcgacctctcaccgctcgcc
ggcatccggctgctccagccgggcgagcgggtcaccggccgccgccgcgccgacggcggc
tggcagctcaccaccgagatccggtacgccgccgacgacgtggtccgcagcggcctcgcc
gaccgggaccggccgaccgacgagcggctggacctggccgctgacgcgttgacccgatcc
gtcgccggcctgcaccggctgcacgacggcgaggtcacgctcggtctctccggcggcaag
gactcccggctcatcgccgcgacgctcgtcgccgccgaccgtacgccggacctggtcacc
aacgacgacacccccgccgagggcgacgtggcccgcgagctggtgcggctcctgcgggac
cggcgcggcctggagctgccgcaccgcctcacacccgcagcgccgccggaaaccgtcctc
ggcaccggcctccgggaccgggcgcgacggctcgccgcgctgcacgaccaccagttcccc
tcgacctacctgacgcgcccggcggcgcggacccggctgcctgacgaggtacgcccgccg
agcctcaccggagcggcaggcgaactggtggtcggcttctggtatccccgccccgacgcc
gacccggcgcccacgcccgagcaggcggccatgagcaagctgctggcggccgtgccgcgc
gggaccacgacgcccgaggcgctggccgccgaacgggaccgcgtcaccgcgctgacggcc
cacgcccgagagctgggcctacgcgacgagcacctgatcgactacgtctacctggtcgag
cggatgcgccgctggtgcacagccgcgtacaccacgggcatggtcaccccgttcctggcg
cccggcttcgtcgcggccagcttcgcgttcaccgcggccgagaagcgggcgcgacttccg
cacaccgcgctgatcgcccggctcgtaccggagtgggcggacgtgccgttcgtcagctcc
gccaccggaccgtcccgtgccacccggatctgggagggcgacggcgtcgccgccgtggcc
gacctgctggacaccgtccacgggccgctcaccgagctgatccggcgtccggccgtggag
cgggagctgcgtaccgccgcccggggcggccggcccgatccgcgggtgctggcccagttc
accgcgctggcggtcgcctccgaacggctggaacccgacttcaccgggccgtcgaccggc
gccacctacgagcgggtcaccgcgccgccgctcccgcgtacgccaccggagagccggctg
gccggactgcgctggctacggcggacccggctcggtgaccggctctgggtcatggtgcgg
cggagggtgcggggccgctga

DBGET integrated database retrieval system