KEGG   Micromonospora aurantiaca: Micau_5884Help
Entry
Micau_5884        CDS       T01296                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mau  Micromonospora aurantiaca
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Micau_5884
Enzymes [BR:mau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Micau_5884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6559227..6559844)
Genome map
AA seq 205 aa AA seqDB search
MAARLISGKLTGGPVEDSVDLARIEKAVREILIAVGEDPDRDGLQQTPARVARAYAELFA
GLRVDPAQVLRTTFEANHEELVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGPDGRITGLS
KLARLVEVFARRPQVQERLTSQIADLLMSSLAPRGVIVVLECEHMCMAMRGIQKSGAKTI
TSAVRGGLQNDAKSRAEAMALIMAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgcctgatcagcggcaagctcaccggtggcccggtggaggacagcgtcgac
ctcgcccggatcgagaaggcggtccgcgagatcctcatcgctgtcggcgaggacccggac
cgtgacggcctccagcagacgcccgcccgggtcgcccgcgcgtacgccgaactcttcgcc
ggcctgcgggtcgaccccgcgcaggtgctccgcaccacgttcgaggccaaccacgaggag
ctggtgctcgtccgggacatcgacgtgatgagcctctgcgagcaccacctgctgccgttc
cggggcagcgcgcacatcggctacatccccggcccggacggccggatcaccggcctgtcc
aagctggcccggctggtcgaggtgttcgcccgccggccgcaggtgcaggagcggctgacc
tcgcagatcgccgacctgctgatgtccagcctcgccccgcgcggcgtgatcgtggtgctg
gagtgcgagcacatgtgcatggcgatgcgcggcatccagaagtccggcgcgaagaccatc
acgtccgccgtgcgcggcggccttcagaacgacgcgaagtcgcgggccgaggcgatggcg
ctgatcatggcccgctga

DBGET integrated database retrieval system