KEGG   Micromonospora aurantiaca: Micau_5950Help
Entry
Micau_5950        CDS       T01296                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mau  Micromonospora aurantiaca
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Micau_5950
DNA repair and recombination proteins [BR:mau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Micau_5950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6635968..6636561)
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLAGALRKVKDLVRFCTTCY
NVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGIGPDN
LRIRELMTRLGGGEVRELILATDPNTEGEATATYLALMVKPMGIAVTRLASGLPVGGDLE
YADEITLGRAFEGRRAV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggtgccatccaggatctgatcgacgagctgggccggttgccgggcgtgggc
ccgaagagcgcccagcggatcgcgttccacgtgctgtcggcggatccggccgacgtcaac
cggctggccggcgcgctgcgcaaggtcaaggacctggtccggttctgcacgacctgctac
aacgtggcggagtcggagcagtgccggatctgccgcgacccacggcgtaccgacgaggtg
ctctgtgtggtcgaggagccgaaggacgtggtggcgatcgagcggaccggcgagttccgc
gggcgctaccacgtgctcggcggtgcgatcaatccgctggagggcatcggcccggacaac
ctgcggatccgtgagctgatgacccgcctcggcggcggcgaggtccgcgagctgatcctc
gccaccgacccgaacaccgagggcgaggcaaccgccacctatctggcgctgatggtcaag
ccgatggggatcgcggtgacccggctcgcgagtggactgccggtcggcggcgacctggag
tacgccgacgagatcacgctgggccgggccttcgagggccgacgggccgtctga

DBGET integrated database retrieval system