KEGG   Micromonospora aurantiaca: Micau_6071Help
Entry
Micau_6071        CDS       T01296                                 

Definition
peptidase A24A prepilin type IV
Orthology
K02654  
leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
mau  Micromonospora aurantiaca
Brite
Enzymes [BR:mau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Micau_6071
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     Micau_6071
Peptidases [BR:mau01002]
 Aspartic Peptidases
  Family A24: type IV prepilin peptidase family
   Micau_6071
Secretion system [BR:mau02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Micau_6071
  Type IVa pilus homolog protein
   Micau_6071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6785341..6786057)
Genome map
AA seq 238 aa AA seqDB search
MNPTVLGLALFGGALAGLALPHVYIWLVAKPQASMDLPPSRAGVSGTSAPRCVPVRSALM
LVAVSELCGTGLAVASAGLAWMLRDIPGGLPLLAVWLVVMHTGMLLAAVDVAVRRLPTPA
ISAAAIAVGVVLASQAATTSQAHTLVTAVLAAATLGGLYLTLVIVAGSGMGLGDVRLAAL
LGAALGAAGWPAVFLGGLLPFLLAVPEALARLALRRAHTIAFGPYLVGGALIAAMVSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccacggtgctggggctggcgctcttcggcggcgccctcgccggcttggcgctg
ccgcacgtgtacatctggctggtggccaagccgcaggccagcatggacctaccaccgtcc
cgggcgggcgtaagcggcacctcggcaccccgctgcgtgcccgtcaggagcgcgctcatg
ctggtggccgtctcggagttgtgtggcaccgggctggctgttgcctccgccggcctggcc
tggatgctgcgcgacatccccggcggactgcctctgctggcggtatggctggtagtgatg
cacaccggcatgcttctagccgccgtcgacgtcgcggtccgcaggctgcccacccccgcg
atcagcgccgccgccatagccgtcggcgtcgtgctggccagccaggcagcgaccacgagc
caggcccacacgttggtcaccgccgtgctcgccgcggcgacgctcggcggcctgtacctg
actttggtcattgtggcgggcagcgggatgggtctgggtgacgtgcggctggccgcgctg
ctcggcgcggcgctaggcgctgccggctggccggcggtgttcctcggcggcctgctgccc
ttcctgctcgccgttcccgaagcactggcgcgcctggcgctgcgccgcgcgcacaccatc
gccttcggcccctatctggtcggcggggcactgatagcagccatggtcagcagctga

DBGET integrated database retrieval system