KEGG   Micromonospora aurantiaca: Micau_6071Help
Entry
Micau_6071        CDS       T01296                                 

Definition
peptidase A24A prepilin type IV
Orthology
K02654  
leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
mau  Micromonospora aurantiaca
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6785341..6786057)
Genome map
AA seq 238 aa AA seqDB search
MNPTVLGLALFGGALAGLALPHVYIWLVAKPQASMDLPPSRAGVSGTSAPRCVPVRSALM
LVAVSELCGTGLAVASAGLAWMLRDIPGGLPLLAVWLVVMHTGMLLAAVDVAVRRLPTPA
ISAAAIAVGVVLASQAATTSQAHTLVTAVLAAATLGGLYLTLVIVAGSGMGLGDVRLAAL
LGAALGAAGWPAVFLGGLLPFLLAVPEALARLALRRAHTIAFGPYLVGGALIAAMVSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccacggtgctggggctggcgctcttcggcggcgccctcgccggcttggcgctg
ccgcacgtgtacatctggctggtggccaagccgcaggccagcatggacctaccaccgtcc
cgggcgggcgtaagcggcacctcggcaccccgctgcgtgcccgtcaggagcgcgctcatg
ctggtggccgtctcggagttgtgtggcaccgggctggctgttgcctccgccggcctggcc
tggatgctgcgcgacatccccggcggactgcctctgctggcggtatggctggtagtgatg
cacaccggcatgcttctagccgccgtcgacgtcgcggtccgcaggctgcccacccccgcg
atcagcgccgccgccatagccgtcggcgtcgtgctggccagccaggcagcgaccacgagc
caggcccacacgttggtcaccgccgtgctcgccgcggcgacgctcggcggcctgtacctg
actttggtcattgtggcgggcagcgggatgggtctgggtgacgtgcggctggccgcgctg
ctcggcgcggcgctaggcgctgccggctggccggcggtgttcctcggcggcctgctgccc
ttcctgctcgccgttcccgaagcactggcgcgcctggcgctgcgccgcgcgcacaccatc
gccttcggcccctatctggtcggcggggcactgatagcagccatggtcagcagctga

DBGET integrated database retrieval system