KEGG   Mycobacterium avium 104: MAV_0326Help
Entry
MAV_0326          CDS       T00433                                 

Definition
(RefSeq) endoglucanase A (EC:3.2.1.4)
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mav  Mycobacterium avium 104
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAV_0326
Enzymes [BR:mav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MAV_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316495..317412
Genome map
AA seq 305 aa AA seqDB search
MGPVAEPAPAIRLAADGNPLAGAPFYVNPNSAAMRAAQSADPPSPELTTIANTPQAYWIV
PGGSAATVGKYVGDANAAGAIPVLAIYGIPHRDCGSFAAGGMASADDYRGWIDGIASGVG
ASRVAIVVEPDALAMADCLSGDQRQERFDLVRYAVDTLTRDPNAAVYVDAGHLRWHSPED
MAARLNQAGVAHARGFSVNTANFYTTEDEIGYGEAISGLTNGAHYVIDTSRNGAGPAPDS
DLNWCNPSGRALGTPPTAATAGAHADAYLWIKRPGESDGSCGKGDPPAGNFVNQYAIDLV
HNVGH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggtagccgaaccggcgccggcgatccgcctggccgccgacggcaatccgttg
gccggggcgccgttctatgtcaatcccaactcggccgccatgcgcgccgcgcagagcgcc
gatccgccgagtcccgagttgaccaccatcgccaacacgccgcaggcgtactggatcgtc
ccgggcggctcggcggcgacggtcgggaagtacgtcggcgacgccaacgctgccggcgcc
atcccggttttggcgatttatggaatcccccaccgcgattgcggcagcttcgccgcgggc
ggcatggcgtcggccgacgactaccgcgggtggatcgacggcatcgcatccggcgtgggc
gcctcgagggtggcgatcgtcgtcgaacccgatgcgctcgcgatggccgactgcctgtcg
ggcgatcagcgccaggaacgtttcgacctggttcgctacgccgttgacacgctgacccgc
gatccgaacgcggccgtgtacgtcgacgccgggcacctgcgttggcacagtcccgaggac
atggccgccaggctgaatcaggccggcgtcgcacacgcgcgaggattcagcgtcaacacc
gcgaacttttacaccaccgaggacgaaatcggttacggcgaagccatttccgggctcacc
aatggtgcgcactacgtgatcgacacctcccgcaacggggccggaccggcacccgactcc
gacctcaactggtgcaaccccagcggtcgcgccctgggcaccccgcccaccgcggccacc
gccggtgcgcacgccgacgcctacttgtggatcaagcgtcccggcgagtccgacggatca
tgcggcaagggcgatccgccggcgggcaacttcgtgaatcagtacgccatcgatctggtg
cacaacgtcggccactag

DBGET integrated database retrieval system