KEGG   Mycobacterium avium 104: MAV_0347Help
Entry
MAV_0347          CDS       T00433                                 

Definition
kinase, PfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mav  Mycobacterium avium 104
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAV_0347
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MAV_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(343455..344333)
Genome map
AA seq 292 aa AA seqDB search
MVVIGQIGRDLVLRTDRPPTAGESATVLRREELLGGKGANQAVGLAQLGVPVTLIGVVGD
DQAGTSILQQAQRDGIDVSKVARRGTTALLVDVVAAPPERMLLEDVPDSSLVRVADLDRS
SSLFDTADTVSIQLQQPAATALEAAQRARQRGLRVVADGVPAPQVRADLLATLDVLRADA
TEASIIAGTEITTVEQAFELADHLLSGGPELVALAVPDVGDLLTWRGGSELFEFADVEVV
DPTGAGDAFVAGLVAALREGAAPREAGRRAAAAAGATVQRLGGRPDLTGLRA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgatcggtcagatcgggcgcgacctggtgctgcgcaccgaccggccgccgacg
gccggcgagtccgccaccgtgctgcggcgcgaggagctgctcggcggcaagggcgccaac
caggccgtcgggctggcgcaactgggtgtgccggtgacgctgatcggggtggtgggcgac
gaccaagccggcacgtcgatcctgcagcaggcgcagcgcgacggcatcgacgtcagcaaa
gtggcgcggcgcggcaccaccgcgctgctggtcgacgtggtcgccgcgccgccggaacgc
atgctgctcgaggacgtgccggacagttcgctggttcgggtcgccgacctggaccggtcg
agctcgctgttcgacaccgccgacaccgtctccattcagctgcagcagccggccgccacc
gctttggaagccgcgcaacgcgcgcggcagcggggactgcgggtggtggccgacggcgtg
cccgccccgcaggttcgggccgatctgctggcgacgctggacgtgctgcgggccgatgcc
accgaagcgtcgatcatcgcgggcaccgaaatcaccacggtggaacaggccttcgagttg
gccgaccatctgctgagcggcggcccggagctggtcgcgctggcggttcccgacgtgggc
gacctgctgacgtggcgtggcggcagcgagcttttcgagttcgccgacgtggaagtggtg
gatcccaccggcgccggtgacgcgttcgtcgccgggctggtggccgccctgcgggagggc
gccgcaccgcgggaggcgggtcggcgggcggccgcggccgctggggccacggtccagcgc
ctgggcgggcggcccgacctgaccgggctcagggcgtga

DBGET integrated database retrieval system