KEGG   Mycobacterium avium 104: MAV_0406Help
Entry
MAV_0406          CDS       T00433                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mav  Mycobacterium avium 104
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MAV_0406 (glpK)
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MAV_0406 (glpK)
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAV_0406 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399863..401389
Genome map
AA seq 508 aa AA seqDB search
MAEFAEFIAAIDQGTTSTRCMIFDHQGAEVARHQLEHEQILPRAGWVEHDPIEIWERTSS
VLTSVLNRANLSAENLAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALDRD
GRGQVIRRKAGLPPATYFSGAKLQWILDNVDGVREAAERGDALFGTADSWVLWQLTGGPR
GGVHATDVTNASRTMLMDLETLDWDDELLSFFTIPRAMLPEIGPSSSPRPFGVTSDTGPA
GGRIPITAVLGDQHAAMVGQVCLAEGEAKNTYGTGNFLLLNTGESIVRSEHGLLTTVCYQ
FGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSESLARQVDDNGGVYFVPAFSGLF
APYWRSDARGAIVGLSRFDTNAHLARATLEAICYQSRDVVDAMAADSGVRLEVLKVDGGI
TGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPGELRANWREDKRWTP
AWSDEQRAAGYAGWRKAVQRTLDWADVT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaattcgccgaattcatcgccgccatcgaccagggcaccaccagcacgcgctgc
atgatcttcgatcaccagggtgccgaggtggcccgccatcagctcgagcacgagcagatc
ctgccccgggcgggctgggtcgagcacgacccgatcgagatctgggagcgcacctcctcg
gtgttgacgtcggtgctcaaccgggccaacctgtccgcggaaaaccttgccgcgctgggc
atcacgaatcagcgcgaaaccaccctggtgtggaaccgcaagaccggccggccctattac
aacgcgatcgtctggcaggacacccggaccgaccggatcgcgtcggcgctcgaccgcgac
gggcgcggccaggtgatccgccgcaaggcgggcctgcccccggcgacctacttctccggg
gcgaagttgcaatggatcctggacaacgtcgacggggtgcgcgaggcggccgagcgcggc
gacgcgttgttcggcaccgccgacagctgggtgttgtggcagctcaccggggggccgcgg
ggcggggtgcacgccaccgacgtgaccaacgccagccggaccatgctgatggacttggag
acgctggactgggacgacgagctgctgtcgttcttcaccatcccgcgcgccatgctgccc
gagatcgggccgtcgtcgtcgccgcggccgttcggggtgacctcggacaccgggccggcc
ggcggccggataccgatcaccgccgtgctgggggatcagcacgcggcgatggtgggccag
gtctgcctggccgagggcgaagccaaaaacacctacggcaccgggaatttcctgctgctc
aacaccggtgagagcatcgtgcggtccgagcacggattgctcaccaccgtgtgctaccag
ttcggcgacgccaaacccgtttacgcacttgagggttcgatcgcggtcaccggcgccgcc
gtgcagtggctgcgcgaccagttgggcatcatcagcggcgccgcgcagagcgaatcgctg
gcgcggcaggtcgacgacaacggcggcgtctatttcgtccccgccttttccgggctgttc
gcgccctactggcgttcggatgcgcgcggcgcgatcgtcgggctgtcgcggttcgacacc
aatgcccacctggcgcgggcgacgctggaggcgatctgctatcagagtcgtgacgtggtg
gacgcgatggcagcggattccggtgtgcgccttgaagttttgaaggtcgacggcggcatc
accggaaacgacctgtgcatgcagatccaggccgatgtgttgggcgtggacgtggtgcgg
ccggtggtggccgagaccaccgcgctgggcgcggcgtacgcggcgggcctggcggtgggg
ttctgggctgacccgggcgagctgcgggccaactggcgcgaagacaagcgctggacgccg
gcctggagcgacgagcagcgcgccgcgggttacgcgggctggcgcaaggcggtgcagcgg
accctggattgggccgacgtcacgtga

DBGET integrated database retrieval system