KEGG   Mycobacterium avium 104: MAV_0462Help
Entry
MAV_0462          CDS       T00433                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
mav00010  Glycolysis / Gluconeogenesis
mav00620  Pyruvate metabolism
mav00640  Propanoate metabolism
mav00680  Methane metabolism
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_0462 (acsA)
   00620 Pyruvate metabolism
    MAV_0462 (acsA)
   00640 Propanoate metabolism
    MAV_0462 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MAV_0462 (acsA)
Enzymes [BR:mav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MAV_0462 (acsA)
Lipid biosynthesis proteins [BR:mav01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MAV_0462 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABK68385
UniProt: A0A0H3A2N1
Position
complement(449938..451890)
Genome map
AA seq 650 aa AA seqDB search
MTASNTANPPSYPPPPQFVEQANAGEQLYREAERDRLAFWAEQANRLSWATPFTEVLDWS
RAPFAEWFADGTLNVAYNCVDRHVQAGHGDRVAIHWEGESPGDQRSLTYSELYTQVCKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGVMHSVVFAGFTAKALQARIADAAAK
LLITSDGQFRRGKPAPLKDAADEAVADPDSPVEHVVVVRRTGIDVSWTDGRDLWWHDVVD
AAAPEHTPEPFPAEQPLFLLYTSGTTGKPKGIVHTSGGYLTQAAYTHYYVFDIKADTDVF
WCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDTPTQHRHFEIIEKYGVTIYYTAPTLI
RTFMKWGREIPDAHDLSSLRLLGSVGEPINPEAWRWYRSVIGADRLPIVDTWWQTETGAT
MISPLPGVAAAKPGSAMRPLPGISARIVDDHGDQLVPGIHHGEHVTGYLVLDQPWPSMLR
GIWGDPDRYVETYWSRFAEQGWYFAGDSAYYDRDGAIWVVGRIDDVMNVSGHRLSTAEVE
SALVGHHGVAEAAVVGATDATTGQAICAFVVLCADYQVHDGIVDELRAEVAREISPIAKP
REVHVVPELPKTRSGKIMRRLLRDIAENRELGDTSTLLDPGVFDAIRAAK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccagcaacaccgcaaaccccccgtcgtatccgccgccgccgcagttcgtcgag
caggccaatgcgggtgagcagttgtaccgcgaggccgagcgggaccggttggcgttctgg
gccgagcaggccaaccggttgtcctgggccacaccgttcaccgaggtgctggactggtcc
cgggcgccgttcgccgagtggttcgcggacggaacgctcaacgtcgcctacaactgcgtg
gaccgccacgtgcaggccggccacggcgaccgggtcgccatccactgggagggcgaatct
cccggcgatcagcgcagtctgacctattccgagctgtacacgcaggtgtgcaaggccgcc
aacgcgctgaccgatctcggtctggtcgccggcgaccgcgtcgccatctatctgccgctg
atccccgaggcggtgatcgcgatgctggcctgcgcgcggctgggcgtcatgcacagcgtg
gtgttcgccggcttcaccgccaaggcgctgcaggcccgcatcgccgacgcggcagccaag
ctgctgatcaccagcgacgggcagttccgccgcggcaagcccgcgccgctcaaggacgcc
gccgacgaggcggtcgccgaccccgacagcccggtcgagcacgttgtggtggtgcggcgc
accggaattgacgtgtcctggaccgacggccgcgacctgtggtggcacgacgtcgtcgac
gccgccgcgcccgaacacacccccgagccgttccccgccgagcagccgctgtttctgctg
tacacctcgggcaccaccggcaagcccaagggcatcgtgcacaccagcggcggatatttg
acccaggccgcctacacgcactactacgtcttcgacatcaaggccgacaccgacgtgttc
tggtgcaccgccgacatcggctgggtcaccggacacacctacggcgtctacggcccgctg
gccaacggggtcaccgaggtgctctacgagggaaccccggacacaccgacccagcaccgg
catttcgagatcatcgaaaaatacggcgtgacaatctattacaccgcgcccacgctgatc
cgcacgttcatgaagtggggccgggaaatccccgacgcgcacgacctgtccagcctgcgg
ctgctgggttcggtcggcgagccgatcaatcccgaggcgtggcgctggtatcgcagcgtg
atcggcgccgaccggctgcccatcgtcgacacctggtggcagaccgagaccggcgccacg
atgatctccccgctgcccggagtcgctgcggccaaaccgggttcggcgatgcggccgctg
ccgggcatctcggccaggatcgtcgacgaccacggcgaccagctggtgccgggcatccac
cacggtgagcacgtcaccggctacctggtgctggaccaaccgtggccgtcgatgctgcgc
ggcatctggggcgaccccgaccgctacgtcgagacctactggtcgcggttcgccgagcag
ggctggtatttcgccggtgacagcgcctattacgaccgcgacggcgccatctgggtggtc
ggccgcatcgacgacgtgatgaacgtgtcggggcatcggctgtccaccgccgaggtggag
tcggcgctggtcggacaccacggcgtcgccgaggcggcggtggtcggcgccaccgacgcc
acgaccggccaggccatctgcgcgttcgtcgtgctgtgcgccgattaccaggtgcacgac
gggatcgtcgacgagctgcgcgccgaggtggcccgggagatttcgccgatcgccaagccg
cgggaggtgcacgtggtgcccgagctgccgaagacccgcagcggcaagatcatgcgccgg
ctgctgcgcgacatcgccgagaaccgcgaattgggcgacacctcaacgctgctcgacccc
ggggtgttcgacgcgatccgggcggcgaagtag

DBGET integrated database retrieval system