KEGG   Mycobacterium avium 104: MAV_0546Help
Entry
MAV_0546          CDS       T00433                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mav  Mycobacterium avium 104
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAV_0546 (folK)
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MAV_0546 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
530589..531137
Genome map
AA seq 182 aa AA seqDB search
MTRVVLSIGSNLGDRLARLQSVVDGLGGAVRAISPVYETQPWGRVDQAPFLNAVLIADDP
ACDGQGWLRRAQEFERAAGRVRGERWGPRTLDVDLIACYGDGEVISRENNLTLPHPLAHL
RAFVLIPWLAVDPDARLTVADGPQPVARLLAQLDQADRDGVRPTGLTLTPPAGSSADSGA
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgttgtcttatccattggctccaatctgggggaccggctggcgcggctgcag
tccgtcgtcgacgggctcggcggcgcggtgcgcgccatctcgccggtgtacgaaacccaa
ccctggggccgggtggatcaggcgccgtttctcaacgcggtgctgatcgccgacgacccg
gcctgcgacggccagggctggctgcgccgggcgcaggaattcgagcgggccgcgggccgg
gtgcggggcgaacgctggggcccgcgcaccctcgacgtcgacctgatcgcctgctacggc
gacggcgaggtgatctcccgggagaacaacctgaccctgccgcatccgctggcgcatctg
cgggccttcgtccttatcccctggctggccgtcgacccggacgcgcggctgacggtggcc
gacgggccgcaaccggtcgcccgcctgctggcccagctggaccaagccgaccgggacggt
gtccggccgaccggcctgacgctgacaccgcccgcgggctcgtcggccgattcgggggcg
ggcagctga

DBGET integrated database retrieval system