KEGG   Mycobacterium avium 104: MAV_0626Help
Entry
MAV_0626          CDS       T00433                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mav  Mycobacterium avium 104
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAV_0626
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAV_0626
   00650 Butanoate metabolism
    MAV_0626
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MAV_0626
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAV_0626
   00622 Xylene degradation
    MAV_0626
   00621 Dioxin degradation
    MAV_0626
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MAV_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
608998..609912
Genome map
AA seq 304 aa AA seqDB search
MPTKAKVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRQHLDAP
NVNMITCGGQATIPIVYAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSRGVET
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIHDVVKEVQSYVPGYRLL
NEPQFDDPSLNSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLSVA
GGTR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaaagcaaaagtggcgattgtcgggtcggggaacatcagcacggacctgctc
tacaagctgctgcgatccgactggctggaaccgcgctggatggtcggcatcgacccgcag
agcgagggcctggcccgggcccgcaagctgggcttggagaccacccacgagggggtcgac
tggctgctggcgcagccggagaaacccgacctggtcttcgaggcgaccagcgcctacgtg
caccgcgacgccgcccccaagtacgaggccgccggcatccgggccatcgacctgacgccc
gccgcggtgggcccggccgtcatcccgccggcgaacctgcgccagcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccacgattccgatcgtctacgccgtcagc
cgcgtcgtcgaggtgccctacgccgagatcgtcgcgtcggtggcgagcgtgtcggcgggc
ccgggcacccgcgccaacatcgacgagttcaccaagaccaccagccggggcgtggagacc
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgaggacgccgaccgggacgcgatcgcg
cagtcgattcacgacgtcgtcaaagaggtgcagagctacgtgcccggctaccggctgctc
aacgagccgcagttcgacgacccgtcgctcaactccggcggccaggcgctggtcaccacg
ttcgtcgaggtcgagggtgccggcgattatctgcccccgtacgcgggcaacctggacatc
atgaccgccgcggccacgaaggtgggcgaggagatcgccaaggagacgctgtcggtggca
ggaggcacgcgatga

DBGET integrated database retrieval system