KEGG   Mycobacterium avium 104: MAV_0981Help
Entry
MAV_0981          CDS       T00433                                 

Definition
acyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mav  Mycobacterium avium 104
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_0981
   01212 Fatty acid metabolism
    MAV_0981
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAV_0981
   00650 Butanoate metabolism
    MAV_0981
  Lipid metabolism
   00071 Fatty acid degradation
    MAV_0981
   01040 Biosynthesis of unsaturated fatty acids
    MAV_0981
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAV_0981
   00310 Lysine degradation
    MAV_0981
   00380 Tryptophan metabolism
    MAV_0981
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAV_0981
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAV_0981
   00281 Geraniol degradation
    MAV_0981
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MAV_0981
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MAV_0981
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAV_0981
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MAV_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917989..920136
Genome map
AA seq 715 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVERLVAEKDSITGVVITSA
KKTFFAGGDLKSMINLGPENAGEAFDTVEAVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGLVVGLPEVTLGLLPGGGGVTRTVRMFGIQNAFMNILSQGTRFKPDK
AKEIGLVDELVGSVEELVPAAKAWIKANPDAHEQPWDKKGYKMPGGTPSSPALAGILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTQLVTGQVAKNMIQAFFF
DLQHINGGGSRPEGIEPVKINKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVSLEAAQKGK
GYSEKLEAKALQRGKTTEEKSKSLLDRITPTADAADFKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
SPPLQLSDELNLELMHKIAVATRKGIEDAGGTYEPHPAEAVVEKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLQETFNSGSTSIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYSGAGGTGKEAFVARAKELAARYGDRFLPPASLTS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccatcaagtgggacaaggacgccgacggcattgtcacgctgacgctc
gacgacccgaccgggtcggccaatgtgatgaacgagcactacaaggaatcgatgcacaac
gctgtcgaacgccttgtggcagagaaggattcgatcaccggtgtggtgatcaccagcgcc
aagaagacgttcttcgccggcggtgacctcaagagcatgatcaacctcggcccggagaac
gccggtgaggcgttcgacaccgtcgaggcggtcaagcgcgacctgcgcgcgctggagacg
ctcggcaagccggtggtggccgccatcaacggcgcggcgctgggcggcgggctggagatc
gcgctggcctgtcaccaccggatcgccgcggacgtcaaggggctggtcgtcggcctgccc
gaggtgaccctgggcctgctgcccggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaacgcgttcatgaacatcctgagccagggcacccggttcaagccggacaag
gccaaggagatcggcctggtcgacgagctggtcggcagcgtcgaggaactggtgcccgcc
gccaaggcgtggatcaaggccaaccccgacgcccacgaacagccttgggacaaaaagggt
tacaagatgcccggcggcaccccgtccagccccgcgctggccggcatcctgccgtcgttc
ccggcgctgctcaaaaagcagctcaagggcgccccgatgcccgcaccgcgtgccatcctg
gacgcggccgtcgagggcgctcaggtggacttcgacaccgccagtcgcatcgagagccgc
tacttcacccagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcacatcaacggcggcggctcccgccccgagggcatcgagccggtcaagatc
aacaagatcggtgtgctcggcgcgggcatgatgggcgccggcatcgcctatgtctcggcc
aaggccggcttcgacgtggtgctcaaggacgtcagcctcgaggccgcccagaagggcaag
ggctactcggaaaagcttgaggccaaagcacttcagcggggcaagaccaccgaggagaag
agcaagtcgctgctggaccgcatcaccccgacggccgacgccgccgacttcaagggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtcttccaggag
atcgaggacatcgtcgagcccaacgcgctgctcggctccaacacctcgacgctgccgatc
accggtctggccaccggtgtcaagcggcaggaggacttcatcgggatccacttcttctcc
ccggtcgacaagatgccgctggtcgaaatcatcaagggcgagaagacttccgacgaggcg
ctggcccgcgtgttcgactacacgctggccattggcaagaccccgatcgtggtcaacgac
agccgcggcttcttcaccagccgcgtcatcggcaccttcgtcaacgaggcgctggccatg
ctcggtgagggcgtggcgccggccagcatcgagcacgccggctcgcaagccggctacccg
tcgccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgtc
gccacccgcaagggcatcgaggacgccggcggcacctacgagccgcaccctgccgaggcg
gtcgtcgagaagatgatcgagatcggccggccgtcgcggttgaagggcgccggcttctac
gagtacgtggacggcaagcgcacccgcttgtggcccggcctgcaggagacgttcaactcc
ggcagcaccagtattccgttgcaggacatgatcgatcggatgctgttcgccgaggcgctg
gagacgcagaagtgcctggacgagggggtgctcacctccaccgccgacgccaacatcggc
tcgatcatgggcatcggtttcccgccgtacaccggtggtagcgcgcagttcatcgtcggc
tactccggtgccggcgggaccggcaaggaggccttcgtggcccgggccaaggagctggcc
gcccgctacggcgaccgcttcctgccgccggcgtcgctcaccagctag

DBGET integrated database retrieval system