KEGG   Mycobacterium avium 104: MAV_1066Help
Entry
MAV_1066          CDS       T00433                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mav  Mycobacterium avium 104
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mav00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MAV_1066
Enzymes [BR:mav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MAV_1066
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MAV_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1004792..1005655
Genome map
AA seq 287 aa AA seqDB search
MPELPEIEALADHLRRHAVGLPIGRVDVAALSVLKTFDPPISALHGQTVVGAERWGKYLG
LRTEGLFLIAHLSRAGWLRWSDRLTAAPLRPGKGPIALRVHLGSPGAAPGFDLTEAGTQK
RLAVWLVDDPARVPGIAALGPDALDLDVDALADLLAGNTGRIKTVITDQKVIAGIGNAYS
DEILHVAKISPFATAGKLSDKQLATLHDAMVTVLTDAVSRSVGQGAAMLKGEKRSGLRVH
ARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKILADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactgcccgagatcgaagcgctggccgaccacctgcggcgccatgccgtcggg
ctgccgatcggccgggtcgacgtcgccgccctgtccgtgctcaagacgttcgacccgccg
atcagcgcgctgcacgggcagaccgtggtgggcgccgagcgctggggcaaatatctgggc
ctgcggaccgagggccttttcctgatcgcccatctgtcccgggcggggtggttgcgctgg
tcggaccggctgaccgcggcgccgctgcggcccggcaagggcccgatcgcactgcgggtg
catctgggctcacccggcgcggcccccggcttcgacctgaccgaggccggcacccagaag
cggctggcggtgtggctcgtcgacgacccggcgcgggtgcctgggatcgccgccctgggc
ccggacgccctggacctggacgtcgacgcgctggccgacctgctggccggcaacaccggc
cggatcaagacggtgatcaccgaccagaaggtgatcgccggcatcggcaacgcctacagc
gacgagatcctgcacgtcgcgaagatctccccgttcgccacggccggcaagttgtctgac
aaacagctggccaccctgcatgacgccatggtcacggtgctcaccgacgcggtgagccgg
tccgtcggccagggggcggccatgctcaagggcgagaagcgttccggattgcgggtgcat
gcccggaccgggttgccgtgcccggtgtgtggcgacaccgtgcgcgaagtgtcgttcgcg
gacaagtcttttcagtattgcccgacgtgccagaccggcggcaagatcctggccgaccgg
cggatgtcgcgtttgctgaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system