KEGG   Mycobacterium avium 104: MAV_1102Help
Entry
MAV_1102          CDS       T00433                                 

Definition
GalU protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mav  Mycobacterium avium 104
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MAV_1102
   00052 Galactose metabolism
    MAV_1102
   00500 Starch and sucrose metabolism
    MAV_1102
   00520 Amino sugar and nucleotide sugar metabolism
    MAV_1102
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MAV_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044546..1045439
Genome map
AA seq 297 aa AA seqDB search
MVVPRTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIVTSEG
KDGVVAHFVEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIGCVEPR
LADDEDAVAVLLPDDLVLPTGVLGTMSKVRAHYGGTVLCAIEVTPEEISAYGVFDVEPVP
DDDPDVLRVKGMVEKPKAEDAPSMFAAAGRYVLDRAIFDALRRIDRGAGGEVQLTDGIAL
LISEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLSEQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgccacgcacggcgattgtgcccgccgccggcctcggtacccgattcctgccc
gcgaccaagacggtccccaaagagctgctgcccgtggtcgatacccccgggatcgagctc
gtcgccgccgaggcggccgaggccggcgccgaacgcctggtgatcgtcacctcggagggc
aaggacggtgtcgtcgcgcacttcgtcgaggacctggtgctcgagagcacgctggaggag
cgcggcaaaaccgcgatgctggacaaggttcggcgggcgccacggctgatcaaggtcgag
tcggtggtgcagagcgagccgctgggactgggccacgcgatcgggtgtgtggaaccgcgg
ctggccgacgacgaggacgcggtcgcggtgctgctgcccgacgacctggtgctgccgacc
ggtgtgctggggaccatgtcgaaggtgcgggcgcactacggcggcacggtgttgtgcgcc
atcgaggtgacgcccgaggagatcagtgcctacggcgtcttcgacgtcgagccggtgccc
gacgacgatccggacgtgctgcgggtcaagggcatggtcgagaagccgaaggccgaggac
gcgccgtcgatgttcgccgcggcgggccgctacgtgctcgaccgcgccatcttcgacgcg
ttgcgccgcatcgaccgcggcgccggcggcgaggtccagctgaccgacgggatcgcgctg
ctgatctccgagggccacccggtgcacgtggtcgtgcaccgcggatctcgacacgacttg
ggaaatcctggcggctacctcaaggctgcggttgactttgcattggaccgtgacgactac
ggcccggacttgcggcagtggttggtggcgcggttaggcctgtccgagcagtaa

DBGET integrated database retrieval system