KEGG   Mycobacterium avium 104: MAV_1149Help
Entry
MAV_1149          CDS       T00433                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mav  Mycobacterium avium 104
Pathway
mav00900  Terpenoid backbone biosynthesis
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01130  Biosynthesis of antibiotics
Module
mav_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAV_1149 (ispE)
Enzymes [BR:mav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MAV_1149 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABK67883
UniProt: A0QBW1
Position
1092247..1093197
Genome map
AA seq 316 aa AA seqDB search
MSDGNTAAAWVPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTIFQAVSLLDEVTVRNAD
VLSLDIVGEGADKLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADA
AAVLVAMNSLWELNVPRRDLRMLAAQLGSDVPFALHGGTALGTGRGEELATVLSRNTFHW
VLAFADGELLTRKVFAELDRLRRAGDPPRLPGPGPVLAALAAGDADQLAPLLGNEMQAAA
VSLNPGLRRTLRAGVQAGALAGIVSGSGPTCAFLCPSAAAAVDVGTEVSGVGVCRTVRVA
SGPVAGARVVPAPTEV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcaacaccgccgcggcttgggtgcccaccgggtcggtcaccgtccgggtg
cccggaaaagtcaacctctacctggccgtcggcgatcgccgcgaggacggctaccacgag
ctgaccacgatttttcaggccgtctcgctgctcgacgaggtgaccgtgcgcaacgccgac
gtgctctcgctcgacatcgtcggcgagggcgccgacaagctgcccaccgacgaacgcaac
ctggcctggcaggccgccgagctgatggccgaacacgtcggccgggcgccggacgtgtcg
atcatgatcgacaagtccatcccggtggccggcgggatggccggcggcagcgccgacgcg
gcggcggtgctggtcgcgatgaactcgctgtgggagctcaacgtgccccgccgcgatctg
cgcatgctcgccgcgcagctgggcagcgacgtgccgtttgcgttgcacggcggcaccgcg
ctgggcaccggccgcggagaggagctggcgacggtattgtcccgcaacacctttcactgg
gtgctggcgttcgccgacggcgagctgctgacccgcaaggtgttcgccgagctggaccgg
ctgcggcgggcgggcgatccgccgcggctgcccgggccgggcccggtgctggccgcgctc
gccgccggcgacgccgaccagttggcgccgctgttgggcaatgaaatgcaggccgccgcg
gtgagcctgaaccccggcctgcgccgcaccctgcgcgccggcgtacaggccggcgcgctg
gcgggcatcgtgtcgggctccggcccgacgtgtgccttcctgtgcccgtcggcggccgcg
gcggtggacgtcggcaccgaggtgtccggggtgggggtgtgccgcacggtgcgggtcgcc
agcggaccggtggccggtgcccgcgtggtcccggcaccgaccgaggtgtga

DBGET integrated database retrieval system