KEGG   Mycobacterium avium 104: MAV_1349Help
Entry
MAV_1349          CDS       T00433                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mav  Mycobacterium avium 104
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mav01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mav00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1305644..1306708
Genome map
AA seq 354 aa AA seqDB search
MLDLTGDPVALTAALVDIPSESRDEARLADEVEAALRSQTSGFEIVRNGNAVLARTDRGR
PSRVLLAGHLDTVPVAGNLPSRREDGDLYGCGTADMKSGDAVFLHLAATVADPAHDLTLV
MYDCEEIDAAANGLGRIQRELPDWLSADVAILGEPTGGYIEAGCQGTLRVVVSATGTRAH
SARSWLGDNAIHKLGAVLQRLAGYQARSVEIDGCTYREGLSAVRIDGGVAGNVIPDAAAV
TVNFRFAPDRSPAEALQHVRDVLDGLDVRIEQTDAAAGALPGLSQPAAKALVEAAGGRVR
AKYGWTDVARFAALGIPALNFGPGDPNLAHRRDERVAVAAITAAADLLRGYLSG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacttgaccggggacccggttgcgctgaccgcggcgctggtggacatccccagc
gaatcgcgcgacgaggcgcggctggccgacgaggtcgaggccgcgctgcggtcccagacg
tccggtttcgagatcgtgcgcaacggcaacgccgtgctggcccgcaccgaccgcgggcgg
ccgtcgcgggtgctgctggccgggcacctggacaccgtgccggtcgccgggaacctgccc
agtcgccgcgaggacggcgacctgtacggctgcggcacggcggacatgaaatccggggat
gccgtcttcctgcatctggccgccaccgtcgccgacccggcgcacgatctgacgctggtc
atgtacgactgcgaggaaatcgacgccgccgcaaacggattgggtcgcatccagcgcgag
ctgccggactggctgtccgccgacgtcgcgatcctgggcgagcccaccggcggctacatc
gaggccggctgccagggcacgctgcgggtggtggtcagcgccaccggaacccgcgcccat
tcggcacgatcctggttgggcgacaacgccattcacaaactgggcgccgtgctgcagcgg
ctggccggctatcaggcccgcagcgtcgagatcgacggctgcacctaccgtgagggcctg
tcggcggtgcggatcgacggcggggtggcgggcaacgtcattccggacgcggcggcggtg
acggtcaacttccgcttcgcccccgaccggtcgccggccgaggcgctgcagcatgtgcgc
gacgtgctcgacggcctcgacgtgcgcatcgaacagaccgacgccgccgcgggcgcgctg
cccgggttgtcccagcccgccgccaaggcactggtcgaggcggccggcggccgggttagg
gccaaatacggctggaccgacgtggcgcgcttcgccgcgctgggcataccggcgctcaac
ttcggccccggggatcccaacctcgcgcaccggcgcgacgaacgggtggcggtcgccgcc
atcaccgccgcggcggacctgctgcgcggttacctgagcggctga

DBGET integrated database retrieval system