KEGG   Mycobacterium avium 104: MAV_1614Help
Entry
MAV_1614          CDS       T00433                                 

Definition
(GenBank) alcohol dehydrogenase B
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
mav00010  Glycolysis / Gluconeogenesis
mav00071  Fatty acid degradation
mav00350  Tyrosine metabolism
mav00625  Chloroalkane and chloroalkene degradation
mav00626  Naphthalene degradation
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_1614
  Lipid metabolism
   00071 Fatty acid degradation
    MAV_1614
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAV_1614
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAV_1614
   00626 Naphthalene degradation
    MAV_1614
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAV_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABK69196
UniProt: A0A0H3A3W8
Position
complement(1576698..1577855)
Genome map
AA seq 385 aa AA seqDB search
MKSRAAILHDVGGPWSVEEFELDPPRAGEVLVQMAAAGLCHSDDHILKGDMSAPNEVMRS
LGLPTMFPTIGGHEGSGIVREVGEGVTDFAPGDHVVMSFVAVCGQCRWCASGMEYLCDVG
IGTMIPGMPTDGTFRHHTAGGGNLGHIAKIGAFAEHTVVSTNSLVKIEQQLPLAPSALLS
CAIPTGYGSAANRAGVCGGDAVVVIGAGGIGTGAIQGARISGAAQIVAVDPVEFKQKSAL
RFGATHSVATIAEALDLVRDLTYGVMADAVVVSPSLITADDVRDALKLTRKGGTCVLTGM
TSQLTRSVNIELQDFILMNKTLAGTIFGSCNPRADIARLARLYQTGQLQLDEMITKRYRL
DEVNDAYDDLLNGKIVRGIIDFGIA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccgggcagcgatcctgcatgacgtcggcggcccttggtcggtcgaggagttc
gagctggacccgccgcgcgccggggaggtcctggtgcagatggccgccgccggtttgtgc
cactccgacgaccacatcctcaagggcgacatgtcggcgcccaacgaggtgatgcgatcg
ctggggctgcccaccatgttccccaccatcggcggccacgagggttcgggcatcgtgcgc
gaggtgggtgagggcgtcaccgatttcgcgccgggcgatcacgtggtgatgtcgttcgtc
gccgtgtgcggccaatgccgttggtgcgcaagcggaatggagtacctctgcgacgtgggc
atcggcaccatgatccctgggatgcccaccgacggcaccttccgccaccacacggccggc
ggcggcaacctcggccacatcgcgaagatcggcgccttcgccgaacacactgtggtgtcg
acgaattcgctggtgaagatcgagcagcagttgccgctggcgccgagcgcgctgctgtcc
tgcgccatcccgaccggctacggctcggccgccaaccgggccggggtgtgcggcggggac
gccgtggtggtgatcggcgccggcggcatcggcaccggagccatccagggcgcccggatc
agcggtgccgcgcagatcgtcgcggtcgacccggtggagttcaagcagaagtcggcgctg
cggttcggcgccacgcacagcgtggcgaccatcgccgaggccctggacctggtgcgggac
ttgacttatggggtgatggccgacgcggtggtggtctcgccgtcgttgatcaccgccgac
gacgtgcgcgacgcgctgaagctgacccgcaagggcggaacctgtgtgctcaccggcatg
acgtcgcagttgacccggtcggtcaacatcgagctgcaggacttcatcctgatgaacaag
acactggcgggcaccatcttcggctcgtgcaaccccagggccgacatcgcccggctggcc
aggctctatcagaccggtcagctgcagctcgacgagatgatcaccaagcgctatcgtctg
gacgaggtcaacgacgcctacgacgacctgctcaacggcaaaatcgtgcggggcatcatc
gatttcgggatcgcctga

DBGET integrated database retrieval system