KEGG   Mycobacterium avium 104: MAV_1677Help
Entry
MAV_1677          CDS       T00433                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mav  Mycobacterium avium 104
Pathway
mav00010  Glycolysis / Gluconeogenesis
mav00020  Citrate cycle (TCA cycle)
mav00620  Pyruvate metabolism
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
Module
mav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_1677
   00020 Citrate cycle (TCA cycle)
    MAV_1677
   00620 Pyruvate metabolism
    MAV_1677
Enzymes [BR:mav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MAV_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABK64803
UniProt: A0A0H2ZT07
Position
1649184..1650350
Genome map
AA seq 388 aa AA seqDB search
MSDERVKPFLVPDLGEGLEEVTVTHWNVAVGDDVELNQVLCTVETAKAEVELPSPYAGRI
VEMNGAEGDVLKVGAVLVRLDTAPESAEPPAAETAPTLVGYGADAGIDTSRRTARPLAAP
PVRKLAKELMVDLGSLRPRSGAVITREDVLSAAHGTGNGAEVRPVQGVQARMADKMTLSH
KEIPAATVSVQVDCTALVRLSERLGPAEQRITPFVLTLRLLVIALRRNEIMNSTWVDTPQ
GPQVRIEHRVHLGVAVATERGLLVPVIADAHTKTTRELASRAAELISGARAGSLTPGELR
GSTFTVSNFGALGVDDGVPVINHPEAAILGMGAIKPRPVAVGTEVVVRPTMSLSAVFDHR
IADGAQAARFVCELRDLIESPETALLDL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgagcgcgtcaaaccgtttctggtcccggatctcggcgagggactcgaagag
gtgaccgtgacgcactggaacgtcgcggtgggcgacgacgtcgagctcaaccaggtgttg
tgcacggtggagacggccaaggccgaggtggagctgcccagcccgtacgcggggcggatc
gtcgaaatgaacggcgccgagggcgatgtgctcaaggtgggcgcggtgctggtgcggctg
gacaccgcccccgagagcgccgagccgccggcggccgagacggcgcccacactggtcggt
tacggcgccgatgccgggatcgacaccagccggcggaccgcccgcccgctggctgcccct
ccggtgcgcaagctggccaaggagctgatggtcgacctcggctcgctgcggccccgctcc
ggcgccgtcatcacccgcgaggatgtgctctcggcggcccacggcaccggcaacggggcc
gaggtccggccggttcagggcgtccaggcccggatggccgacaaaatgaccttgtcgcac
aaggagattccggccgcgacggttagcgtgcaggtcgactgcaccgcactggtccggctg
tccgagcggctgggtccggcggagcagaggataacgccgttcgtgctgacgctgcggctg
ctggtcatcgcgttgcgccgcaacgagatcatgaactcgacctgggtcgacaccccgcag
gggccgcaggtgcgcatcgagcatcgggtgcacctgggcgtcgcggtggccaccgaacgg
ggcctgctggtgccggtcatcgccgacgcacacaccaagacgactcgtgaattagcaagt
cgggcagcagaattgatctccggcgcgcgtgccggctcgctcacgccgggggagctgcgg
ggatcgacgttcaccgtgtcgaacttcggggcgctgggcgtggacgacggtgtgcccgtg
atcaaccaccccgaagcggccatcctggggatgggtgcgatcaagccacgcccggtggcc
gtcggcacggaggtcgtggtgcgcccgaccatgtcgctcagcgccgtgttcgaccaccgc
atcgccgacggcgcgcaggcggctcgattcgtttgcgagctgcgggatttgatcgaatcg
ccggaaaccgcgctgctggatttgtga

DBGET integrated database retrieval system