KEGG   Mycobacterium avium 104: MAV_2129Help
Entry
MAV_2129          CDS       T00433                                 

Definition
3'(2'),5'-bisphosphate nucleotidase, putative
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mav  Mycobacterium avium 104
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MAV_2129
Enzymes [BR:mav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MAV_2129
Transfer RNA biogenesis [BR:mav03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MAV_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2137884..2138612
Genome map
AA seq 242 aa AA seqDB search
MNDHELAARLATEAGRLLLGVRDEFADAPASERKAAGDKRSHDFLIEALAAERPGDAVLS
EEGADDPVRLRSERVWIVDPLDGTREFSELGRDDWAVHVALWEAGELVAGAVALPAQGVT
FATPEVASPPVAPGKPRIVVSRTRPPAIALNVRDALDGVLVEMGSAGAKVASVVQGLSDV
YVHAGGQFEWDSAAPVAVARAAGLHTSRIDGSALAYNQPDPKLPDLVVCRPELADAVLAV
TR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccatgagctggccgcgcggttggccaccgaggccggtcggctgctgctgggg
gttcgggacgagttcgccgacgctccggcaagcgagcggaaagcggcgggggacaagcga
tcccacgattttctgatcgaggcgctggctgccgaacggcccggcgatgcggtgctgtcc
gaggagggcgccgacgacccggtgcgattgcgctccgagcgggtctggatcgtcgacccg
ctggacggcacgcgggagttctccgagctcggccgcgacgactgggcggtgcacgtcgcg
ctctgggaggccggcgagctggtggccggcgcggtggcactgccggcgcagggcgtcacg
ttcgcgacccccgaggtcgcgtcaccccccgtcgcgccgggcaagccgcgcatcgtggtg
tcgcgcacccgcccgcccgccatcgcgttgaacgtgcgggacgcgttggacggtgttctg
gtggaaatgggttcggccggcgccaaggtggcctcggtcgtccaggggctctccgacgtg
tacgtgcacgccggcggccagttcgaatgggactcggccgcgccggtcgcggtggcgcgg
gccgccggtttgcacacgtcgcgcatcgacgggtcggcgctggcctacaaccaacccgac
ccgaagctgcccgatctggtggtctgccgtcccgagctggccgacgccgtcctcgcggtc
acccgctga

DBGET integrated database retrieval system