KEGG   Mycobacterium avium 104: MAV_2211Help
Entry
MAV_2211          CDS       T00433                                 

Definition
bifunctional RNase H/acid phosphatase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
mav  Mycobacterium avium 104
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_2211
   01230 Biosynthesis of amino acids
    MAV_2211
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_2211
  Energy metabolism
   00680 Methane metabolism
    MAV_2211
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAV_2211
Enzymes [BR:mav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     MAV_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2215244..2216395
Genome map
AA seq 383 aa AA seqDB search
MKVVIEADGGSRGNPGPAGYGAVVWTPDRGTVLAENKQAIGRATNNVAEYRGLIAGLDDA
LKLGATEAEVYLDSKLLVEQMSGRWKVKHPDLIELHAQARGLAARFDRISYSWIPRERNS
HADRLANEAMDAAAAATGTAEKPEPAEKPGRAEQSDPTAVDAGKTAAAPSPAAPGWTGAR
GTPTRLLLLRHGQTELSVQRRYSGRGNPALTETGRRQADAAARYLAARGGISAVFASPLQ
RAYDTAAVAAKALGLDVTVDDDLIETDFGAWEGLTFGEAAERDPGLHRRWLRDTSTAPPG
GESFDSVAERVSRVRQKIIAAQQGSTVLVVSHVTPIKMLLREALDAGPGILYRLHLDLAS
LSIAEFYSDGAASVRLVNQTGYL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgtcatcgaagccgacggcggatcgcgcggcaaccccggccccgccgggtac
ggcgccgtggtgtggacaccggaccgcggcaccgtgctggccgagaacaagcaggccatc
ggccgggccaccaacaacgtcgccgaataccgcggcctgatagccggtttggacgacgcg
ctgaagctgggcgccaccgaggccgaggtctacctggattccaagctgttggtggagcag
atgtcggggcggtggaaggtcaaacaccccgacctgatcgaactgcacgcccaggcccga
ggcctggcggcgcggttcgacaggatcagctactcgtggattccccgcgagcgcaactcg
cacgccgaccggctggccaacgaggcgatggacgcggccgccgcggccaccggcacggcg
gaaaagcccgagccggcggaaaagcccgggcgggccgaacaatccgatccgaccgccgtc
gacgccgggaaaaccgccgcggcgccgtcaccggcggcgcccgggtggaccggggcgcgt
ggcaccccgacccggctgctgttgctgcgacacgggcagaccgaattgtcggtgcagcgc
cgctattccgggcgcggcaaccccgcactcaccgagacgggacggcggcaggccgacgcg
gcggcacgctatctggccgcgcgcggcgggatttcggcggtgttcgcctccccgctgcaa
cgggcctacgacaccgcggcggtcgccgccaaggcgctgggcctggacgtgaccgtcgac
gacgacctgatcgaaaccgatttcggggcctgggaggggttgacgttcggcgaggccgcc
gagcgcgaccccggactgcaccggcgctggctgcgtgacaccagcaccgctccgccgggc
ggggagagcttcgactcggtggccgagcgggtgtcgcgggttcgccagaagatcatcgcc
gcacagcagggcagcaccgtgctggtggtgtcgcacgtgacgccgatcaagatgctgctg
cgggaggcgctggacgccgggccgggcatcctgtaccggttgcatctcgacctcgcctcg
ctgagcatcgccgagttctattccgacggagccgcttcggtgcggctggtcaaccagacc
ggatacctgtag

DBGET integrated database retrieval system