KEGG   Mycobacterium avium 104: MAV_2239Help
Entry
MAV_2239          CDS       T00433                                 

Gene name
panB
Definition
3-methyl-2-oxobutanoate hydroxymethyltransferase (EC:2.1.2.11)
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
mav  Mycobacterium avium 104
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MAV_2239 (panB)
Enzymes [BR:mav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     MAV_2239 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2245609..2246466)
Genome map
AA seq 285 aa AA seqDB search
MSEHNVYGAAQPAQPAQPAQPRTRIRTHHLQKMKAEGHKWAMLTAYDYSTARIFDEAGIP
VLLVGDSAANVVYGYDTTVPVSIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPAAALA
AATRFMKEGGAHAVKLEGGERVAEQIAHLTAAGIPVMAHIGFTPQSVNSLGGFRVQGRGD
AAEQTIADAIAVAEAGAFSVVMEMVPAGLATQITGKLTIPTIGIGAGPNCDGQVLVWQDM
AGMSSGKSARFVKRFADIGGELRRAATQYAHEVAAGVFPADEHCF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcacaatgtttacggtgccgcccagccggcccagcccgcccaacctgcccag
ccgcgcaccaggattcgcacccaccatctgcagaagatgaaggccgagggccacaagtgg
gccatgctgacggcgtacgactattccaccgcccgcatcttcgacgaggccggcatcccg
gtgctgctggtgggcgactcggcggccaacgtcgtctacggctacgacaccacggtgccg
gtgtcgatcgacgagctgatcccgctggtccgcggcgtggtgcggggggcaccgcacgcc
ctggtggtcgccgatctgccgttcggcagctacgaggccgggccggccgccgcgctggcc
gccgccacccggttcatgaaggagggcggcgcgcacgcggtgaagctggagggcggcgaa
cgggtggccgagcagatcgctcacctgaccgcggccggcatcccggtgatggcgcacatc
ggcttcaccccgcagagcgtgaacagcctgggcggtttccgggtgcagggccgcggcgac
gcggccgaacagaccatcgccgacgcgatcgccgtcgccgaagccggagcgttctcggtg
gtgatggagatggtgccggccgggctggccacccagatcaccggcaagctcaccatcccg
accatcgggatcggcgccggccccaactgcgacggccaggttctggtttggcaggacatg
gccggcatgagcagcggcaagtccgcccgcttcgtcaagcgcttcgccgacatcggcggc
gaattgcgccgcgccgcaacgcagtatgcgcacgaggtggccgccggggtcttcccggcc
gacgaacactgcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system