KEGG   Mycobacterium avium 104: MAV_2267Help
Entry
MAV_2267          CDS       T00433                                 

Gene name
glnA
Definition
glutamine synthetase, type I (EC:6.3.1.2)
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
mav  Mycobacterium avium 104
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAV_2267 (glnA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAV_2267 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    MAV_2267 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAV_2267 (glnA)
   00330 Arginine and proline metabolism
    MAV_2267 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAV_2267 (glnA)
Enzymes [BR:mav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     MAV_2267 (glnA)
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAV_2267 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2271617..2273053)
Genome map
AA seq 478 aa AA seqDB search
MTETTPDDVFKLAKDEKVEFVDVRFCDLPGIMQHFTIPVSFFDESVFEDGLAFDGSSIRG
FQSIHESDMLLLPDPATAQIDLFREAKTLNLNFFVHDPFTLEPYSRDPRNIARKAENYLI
STGVADTAYFGAEAEFYIFDSVSFDSRTNGSFYEIDAISGWWNTGSPNELDGSPNRGYKV
RPKGGYFPVAPVDHYVDLRDQMLSNLIKAGFSLEKGHHEVGTGGQAEINYKFNTLLHAAD
DMMLYKYIVKNTAWQNGKTVTFMPKPLFGDNGSGMHTHQSLWKDGSPLMYDETGYAGLSD
TARHYIGGLLHHAPSLLAFTNPTTNSYKRLVPGFEAPINLVYSQRNRSACVRIPITGTNP
KAKRLEFRCPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAANIPQAP
TQLSAVIDRLEEDHEYLTEGGVFTPDLIETWISFKRETEILPVQVRPHPYEFALYYDV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaaacgacgcccgacgacgtcttcaaactcgccaaggacgagaaagtcgaattt
gtcgacgtccggttctgtgacctacccggcatcatgcagcacttcacaatcccggtttcg
tttttcgacgagagcgtcttcgaggacggcctggccttcgacggctcgtccattcgcgga
ttccagtccattcacgaatccgacatgttgctcctgccggacccggccacggcccagatc
gacctgttccgcgaggccaagacgctgaacctgaacttcttcgtgcacgacccgttcacc
ctcgagccgtactcgcgcgacccgcgcaacatcgcccgcaaggcggagaactacctgatc
tccaccggtgtggccgacaccgcgtacttcggcgccgaggccgagttctacatcttcgac
tcggtgagcttcgactcgcgcaccaacggctcgttctacgagatcgacgccatctcgggc
tggtggaacaccggctcgcccaacgagctcgacggcagccccaaccgcggctacaaggtc
cgccccaaggggggctacttccccgtcgcccccgtcgaccactacgtcgacctgcgcgac
cagatgctgtccaacctgatcaaggccggcttcagcctggagaagggccaccacgaggtg
ggcaccggcggccaggccgagatcaactacaagttcaacacgctgctgcacgccgccgac
gacatgatgctctacaagtacatcgtcaagaacaccgcgtggcagaacggcaagaccgtc
acgttcatgcccaagccgctgttcggggacaacggctccggcatgcacacccatcagtcg
ctgtggaaggacggcagcccgctgatgtacgacgagacgggctacgccggtctgtcggac
accgcgcggcactacatcggcggcctgctacaccacgcgccgtcgctgctggcgttcacc
aacccgacgacgaactcctacaagcgcctggtgccgggcttcgaggcgccgatcaacctg
gtctacagccagcgcaaccgctcggcgtgtgtgcgcatcccgatcaccggcaccaacccg
aaggccaagcggctcgagttccgttgccccgactcctcgggcaacccgtacctggcgttc
tcggccatgctgatggccggcctggacggcatcaagaacaagatcgagccgcaggcgccg
gtcgacaaggacctctacgagctgccgcccgaggaggccgccaacatcccgcaggcgccg
acccagctgtccgcggtgatcgaccggctggaagaggaccacgaatacctcaccgaggga
ggcgttttcacgcccgacctgatcgagacgtggatcagcttcaagcgcgagaccgagatc
ctgccggtccaggtccggccgcacccctatgaattcgcgctgtactacgacgtgtag

DBGET integrated database retrieval system