KEGG   Mycobacterium avium 104: MAV_2267Help
Entry
MAV_2267          CDS       T00433                                 

Gene name
glnA
Definition
(GenBank) glutamine synthetase, type I
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
mav  Mycobacterium avium 104
Pathway
mav00220  Arginine biosynthesis
mav00250  Alanine, aspartate and glutamate metabolism
mav00630  Glyoxylate and dicarboxylate metabolism
mav00910  Nitrogen metabolism
mav01100  Metabolic pathways
mav01120  Microbial metabolism in diverse environments
mav01230  Biosynthesis of amino acids
mav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAV_2267 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    MAV_2267 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAV_2267 (glnA)
   00220 Arginine biosynthesis
    MAV_2267 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAV_2267 (glnA)
Enzymes [BR:mav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     MAV_2267 (glnA)
Exosome [BR:mav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAV_2267 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-ProteinID: ABK66657
UniProt: A0A0H2ZVV6
Position
complement(2271617..2273053)
Genome map
AA seq 478 aa AA seqDB search
MTETTPDDVFKLAKDEKVEFVDVRFCDLPGIMQHFTIPVSFFDESVFEDGLAFDGSSIRG
FQSIHESDMLLLPDPATAQIDLFREAKTLNLNFFVHDPFTLEPYSRDPRNIARKAENYLI
STGVADTAYFGAEAEFYIFDSVSFDSRTNGSFYEIDAISGWWNTGSPNELDGSPNRGYKV
RPKGGYFPVAPVDHYVDLRDQMLSNLIKAGFSLEKGHHEVGTGGQAEINYKFNTLLHAAD
DMMLYKYIVKNTAWQNGKTVTFMPKPLFGDNGSGMHTHQSLWKDGSPLMYDETGYAGLSD
TARHYIGGLLHHAPSLLAFTNPTTNSYKRLVPGFEAPINLVYSQRNRSACVRIPITGTNP
KAKRLEFRCPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAANIPQAP
TQLSAVIDRLEEDHEYLTEGGVFTPDLIETWISFKRETEILPVQVRPHPYEFALYYDV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaaacgacgcccgacgacgtcttcaaactcgccaaggacgagaaagtcgaattt
gtcgacgtccggttctgtgacctacccggcatcatgcagcacttcacaatcccggtttcg
tttttcgacgagagcgtcttcgaggacggcctggccttcgacggctcgtccattcgcgga
ttccagtccattcacgaatccgacatgttgctcctgccggacccggccacggcccagatc
gacctgttccgcgaggccaagacgctgaacctgaacttcttcgtgcacgacccgttcacc
ctcgagccgtactcgcgcgacccgcgcaacatcgcccgcaaggcggagaactacctgatc
tccaccggtgtggccgacaccgcgtacttcggcgccgaggccgagttctacatcttcgac
tcggtgagcttcgactcgcgcaccaacggctcgttctacgagatcgacgccatctcgggc
tggtggaacaccggctcgcccaacgagctcgacggcagccccaaccgcggctacaaggtc
cgccccaaggggggctacttccccgtcgcccccgtcgaccactacgtcgacctgcgcgac
cagatgctgtccaacctgatcaaggccggcttcagcctggagaagggccaccacgaggtg
ggcaccggcggccaggccgagatcaactacaagttcaacacgctgctgcacgccgccgac
gacatgatgctctacaagtacatcgtcaagaacaccgcgtggcagaacggcaagaccgtc
acgttcatgcccaagccgctgttcggggacaacggctccggcatgcacacccatcagtcg
ctgtggaaggacggcagcccgctgatgtacgacgagacgggctacgccggtctgtcggac
accgcgcggcactacatcggcggcctgctacaccacgcgccgtcgctgctggcgttcacc
aacccgacgacgaactcctacaagcgcctggtgccgggcttcgaggcgccgatcaacctg
gtctacagccagcgcaaccgctcggcgtgtgtgcgcatcccgatcaccggcaccaacccg
aaggccaagcggctcgagttccgttgccccgactcctcgggcaacccgtacctggcgttc
tcggccatgctgatggccggcctggacggcatcaagaacaagatcgagccgcaggcgccg
gtcgacaaggacctctacgagctgccgcccgaggaggccgccaacatcccgcaggcgccg
acccagctgtccgcggtgatcgaccggctggaagaggaccacgaatacctcaccgaggga
ggcgttttcacgcccgacctgatcgagacgtggatcagcttcaagcgcgagaccgagatc
ctgccggtccaggtccggccgcacccctatgaattcgcgctgtactacgacgtgtag

DBGET integrated database retrieval system