KEGG   Mycobacterium avium 104: MAV_2273Help
Entry
MAV_2273          CDS       T00433                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mav  Mycobacterium avium 104
Pathway
mav00020  Citrate cycle (TCA cycle)
mav00310  Lysine degradation
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01200  Carbon metabolism
Module
mav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAV_2273 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MAV_2273 (sucB)
Enzymes [BR:mav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MAV_2273 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H TonB_N
Motif
Other DBs
NCBI-ProteinID: ABK66846
UniProt: A0A0H2ZWB0
Position
complement(2277171..2278961)
Genome map
AA seq 596 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAADDAAAGGGAQAPSQPSQPQAPAQPEPQAQAQPEAPAQPQA
PAQPAPQESGGGAATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEI
PSPVAGVLISITAEEDSTVPVGGELARIGTGAQAPAPAAPQPPPAPKPEPKPEPAPQPQA
QPAPQPQPQPQAQPAPEPKAQPAQAQPAQAQPAAGGEGTPYVTPLVRKLAAENNIDLSSI
TGTGVGGRIRKQDVLAAAEQKQRQQQAAAQPSAAPAPAAAEARKPAAPTPAPALAHLRGT
TQKASRIRQITAAKTRESLLATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLPF
IARAVIDALKIHPNINASYNEETKEITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSLAGL
ARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRP
RVIVDEFGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggggacacggtcgaactcgacgagccgctggtcgaggtgtcc
accgacaaggtcgacaccgagatcccgtcgcctgccgcgggtgtgctgaccaagatcatc
gcccaggaagacgacaccgtggaggtgggcggcgaactggccgtgatcggcgacgcggcc
gacgacgccgccgccggcggcggggcgcaggcccccagccagccgagccagccgcaagca
ccggcccagcccgagccccaggcccaggcccagcccgaggccccggcccagccgcaggcg
ccggcccagccggcgccgcaggagtccggtggcggcgccgccaccccggtgttgatgccc
gagctgggcgagtcggtgaccgagggcaccgtgacccgctggctcaagaaggtcggggat
tcggtccaggtcgacgacgcgctggtcgaggtgtccaccgacaaggtcgacaccgagatc
ccgtcgccggtggccggcgtgctgatcagcatcacggccgaggaggacagcaccgtgccg
gtcggcggcgagctggcccgcatcggcaccggcgcccaggcgcccgcccccgctgcgccc
caacccccgccggcccccaagcccgaaccgaaacccgaaccggcaccccaaccccaggcg
cagcccgcgccccagccacagccacagccacaagcccagccggcgcccgagccgaaagcc
caaccggctcaagcccaaccggctcaagcccagccggccgccggcggcgagggcaccccc
tacgtgacaccgctggtgcgaaagctggccgccgagaacaacatcgacctgtcgtcgatc
accggcaccggcgtgggtggtcgcatccgcaagcaagacgtcctggccgccgccgagcag
aagcagcggcaacaacaggccgccgcccagccgtcggccgcaccggcccccgcggccgcc
gaggcccgcaagcccgccgcgccgacgccggcgccggcgctggcgcacctgcgcggcacc
acccagaaggccagccggatccgtcagatcaccgcggccaagacgcgcgaatccctgctt
gccacagcccaactcacccagacccatgaggtcgacatgaccaggctggtcggattgcgg
gcccgggccaaggcggcgttcgccgagcgcgagggggtgaacctgacgttcctgccgttc
atcgcccgcgcggtgatcgacgcgctgaagatccaccccaacatcaacgccagttacaac
gaggaaaccaaggagatcacctactacgacgccgagcacctcggcttcgcggtcgacacc
gaacaggggctgctgtcccccgtcgtgcacaacgccggcgacctgtcgctggccgggctg
gcccgggcgatcgccgacatcgccgcgcgcgcccggtcgggcaacctcaagcccgacgag
ctgtccggcggcaccttcacgatcaccaacatcggcagccagggcgcgctgttcgacacc
ccgatcctggtcccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccg
cgggtgatcgtcgacgagttcggcaacgagtcgatcggcgtgcgctccgtctgctacctg
ccgctgacctacgaccaccggctgatcgacggcgccgacgccggccgcttcctgaccacc
atcaagcaccggctcgaagagggagcattcgaggccgacctcgggctgtga

DBGET integrated database retrieval system