KEGG   Mycobacterium avium 104: MAV_2273Help
Entry
MAV_2273          CDS       T00433                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mav  Mycobacterium avium 104
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAV_2273 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAV_2273 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MAV_2273 (sucB)
Enzymes [BR:mav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MAV_2273 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2277171..2278961)
Genome map
AA seq 596 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAADDAAAGGGAQAPSQPSQPQAPAQPEPQAQAQPEAPAQPQA
PAQPAPQESGGGAATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEI
PSPVAGVLISITAEEDSTVPVGGELARIGTGAQAPAPAAPQPPPAPKPEPKPEPAPQPQA
QPAPQPQPQPQAQPAPEPKAQPAQAQPAQAQPAAGGEGTPYVTPLVRKLAAENNIDLSSI
TGTGVGGRIRKQDVLAAAEQKQRQQQAAAQPSAAPAPAAAEARKPAAPTPAPALAHLRGT
TQKASRIRQITAAKTRESLLATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLPF
IARAVIDALKIHPNINASYNEETKEITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSLAGL
ARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRP
RVIVDEFGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggggacacggtcgaactcgacgagccgctggtcgaggtgtcc
accgacaaggtcgacaccgagatcccgtcgcctgccgcgggtgtgctgaccaagatcatc
gcccaggaagacgacaccgtggaggtgggcggcgaactggccgtgatcggcgacgcggcc
gacgacgccgccgccggcggcggggcgcaggcccccagccagccgagccagccgcaagca
ccggcccagcccgagccccaggcccaggcccagcccgaggccccggcccagccgcaggcg
ccggcccagccggcgccgcaggagtccggtggcggcgccgccaccccggtgttgatgccc
gagctgggcgagtcggtgaccgagggcaccgtgacccgctggctcaagaaggtcggggat
tcggtccaggtcgacgacgcgctggtcgaggtgtccaccgacaaggtcgacaccgagatc
ccgtcgccggtggccggcgtgctgatcagcatcacggccgaggaggacagcaccgtgccg
gtcggcggcgagctggcccgcatcggcaccggcgcccaggcgcccgcccccgctgcgccc
caacccccgccggcccccaagcccgaaccgaaacccgaaccggcaccccaaccccaggcg
cagcccgcgccccagccacagccacagccacaagcccagccggcgcccgagccgaaagcc
caaccggctcaagcccaaccggctcaagcccagccggccgccggcggcgagggcaccccc
tacgtgacaccgctggtgcgaaagctggccgccgagaacaacatcgacctgtcgtcgatc
accggcaccggcgtgggtggtcgcatccgcaagcaagacgtcctggccgccgccgagcag
aagcagcggcaacaacaggccgccgcccagccgtcggccgcaccggcccccgcggccgcc
gaggcccgcaagcccgccgcgccgacgccggcgccggcgctggcgcacctgcgcggcacc
acccagaaggccagccggatccgtcagatcaccgcggccaagacgcgcgaatccctgctt
gccacagcccaactcacccagacccatgaggtcgacatgaccaggctggtcggattgcgg
gcccgggccaaggcggcgttcgccgagcgcgagggggtgaacctgacgttcctgccgttc
atcgcccgcgcggtgatcgacgcgctgaagatccaccccaacatcaacgccagttacaac
gaggaaaccaaggagatcacctactacgacgccgagcacctcggcttcgcggtcgacacc
gaacaggggctgctgtcccccgtcgtgcacaacgccggcgacctgtcgctggccgggctg
gcccgggcgatcgccgacatcgccgcgcgcgcccggtcgggcaacctcaagcccgacgag
ctgtccggcggcaccttcacgatcaccaacatcggcagccagggcgcgctgttcgacacc
ccgatcctggtcccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccg
cgggtgatcgtcgacgagttcggcaacgagtcgatcggcgtgcgctccgtctgctacctg
ccgctgacctacgaccaccggctgatcgacggcgccgacgccggccgcttcctgaccacc
atcaagcaccggctcgaagagggagcattcgaggccgacctcgggctgtga

DBGET integrated database retrieval system