KEGG   Mycobacterium avium 104: MAV_2360Help
Entry
MAV_2360          CDS       T00433                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mav  Mycobacterium avium 104
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mav00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2361422..2362216
Genome map
AA seq 264 aa AA seqDB search
MTPRNPSDEMTDAALAADLAAEAGELLLKVRDEVGFGYPWALGDAGDSLANALILGRLQA
ERPDDAVLSEEAYDDLSRLQHDRVWIIDPLDGTREFSTPGRDDWAVHVALWQRPTNGRRE
ITDAAVSLPARGNIVYRSDTVTASAARVGVTDTIRIAVSATRPPAVLHRMRQRLPIQPVA
IGSAGAKAMAIIDGVVDAYLHAGGQWEWDSAAPAGVVMAAGMHASRLDGSPMRYNQLDPY
LPDFVMCRAELAPVLLGAIRDAWR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccgcaacccgtcggacgagatgaccgacgccgcgctggccgccgatctcgcc
gccgaagcgggggaattactgctgaaggtccgcgacgaggtcggcttcggctatccgtgg
gcgctcggcgacgcgggcgacagcctggcgaatgcgctgatcctgggacggttgcaggcc
gagcggccggacgatgccgtgctcagcgaggaggcctacgacgacctgtcccggctgcag
cacgaccgggtgtggatcatcgacccgctggacggcacgcgcgagttctccacgccgggc
cgcgacgactgggccgtgcacgtcgcgctgtggcagcgcccgaccaacggccggcgcgag
atcaccgacgccgcggtgtcattgccggcccgcggcaacatcgtctaccgcagcgacacc
gtcaccgccagcgccgcgcgcgtcggcgtcaccgacaccatccgcatcgccgtcagcgcc
acccggccgcccgccgttttgcaccggatgcgccagcggttgcccatccagcccgtcgcg
atcggttcggccggcgccaaggcgatggcgatcatcgacggcgtggtcgacgcctatctg
cacgccgggggtcagtgggagtgggactcggccgccccggccggggtggtgatggccgcc
gggatgcacgcatcgcggctggacggttcgccgatgcgctacaaccagctcgacccctac
ctgccagacttcgtcatgtgccgcgccgagctggcgcccgtgctgctgggcgcgatccgc
gacgcgtggcgctag

DBGET integrated database retrieval system