KEGG   Mycobacterium avium 104: MAV_2360Help
Entry
MAV_2360          CDS       T00433                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mav  Mycobacterium avium 104
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MAV_2360
Enzymes [BR:mav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MAV_2360
Transfer RNA biogenesis [BR:mav03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MAV_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2361422..2362216
Genome map
AA seq 264 aa AA seqDB search
MTPRNPSDEMTDAALAADLAAEAGELLLKVRDEVGFGYPWALGDAGDSLANALILGRLQA
ERPDDAVLSEEAYDDLSRLQHDRVWIIDPLDGTREFSTPGRDDWAVHVALWQRPTNGRRE
ITDAAVSLPARGNIVYRSDTVTASAARVGVTDTIRIAVSATRPPAVLHRMRQRLPIQPVA
IGSAGAKAMAIIDGVVDAYLHAGGQWEWDSAAPAGVVMAAGMHASRLDGSPMRYNQLDPY
LPDFVMCRAELAPVLLGAIRDAWR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccgcaacccgtcggacgagatgaccgacgccgcgctggccgccgatctcgcc
gccgaagcgggggaattactgctgaaggtccgcgacgaggtcggcttcggctatccgtgg
gcgctcggcgacgcgggcgacagcctggcgaatgcgctgatcctgggacggttgcaggcc
gagcggccggacgatgccgtgctcagcgaggaggcctacgacgacctgtcccggctgcag
cacgaccgggtgtggatcatcgacccgctggacggcacgcgcgagttctccacgccgggc
cgcgacgactgggccgtgcacgtcgcgctgtggcagcgcccgaccaacggccggcgcgag
atcaccgacgccgcggtgtcattgccggcccgcggcaacatcgtctaccgcagcgacacc
gtcaccgccagcgccgcgcgcgtcggcgtcaccgacaccatccgcatcgccgtcagcgcc
acccggccgcccgccgttttgcaccggatgcgccagcggttgcccatccagcccgtcgcg
atcggttcggccggcgccaaggcgatggcgatcatcgacggcgtggtcgacgcctatctg
cacgccgggggtcagtgggagtgggactcggccgccccggccggggtggtgatggccgcc
gggatgcacgcatcgcggctggacggttcgccgatgcgctacaaccagctcgacccctac
ctgccagacttcgtcatgtgccgcgccgagctggcgcccgtgctgctgggcgcgatccgc
gacgcgtggcgctag

DBGET integrated database retrieval system