KEGG   Mycobacterium avium 104: MAV_2472Help
Entry
MAV_2472          CDS       T00433                                 

Definition
isochorismatase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mav  Mycobacterium avium 104
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MAV_2472
Enzymes [BR:mav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MAV_2472
    3.5.1.-  
     MAV_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2506415..2506975
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSVPVAGGAAVAPAINAYLDDAPGYDYVVATQDFHIDPGDHFSD
RPDYSSSWPAHCLAGSAGADFRPELDTTRVDAVFRKGAYAAGYSGFEGVDDNGTPLLEWL
RRRGVDEVDVVGIATDHCVRRTAEDAARAGLTTRVLVHLTAAAAEDSAARALDEMRSAGI
ELVGAR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgttgatcatcgtcgacgtgcaaaacgatttctgcgagggcggctcggtgccg
gtggccggtggcgcggccgtggcgcccgccatcaacgcctacctggacgacgctccgggc
tacgactacgtggtggcgacgcaggatttccacatcgacccgggtgatcacttctccgac
cggcccgactattcgtcgtcctggccggcgcactgcctcgccggcagcgccggcgccgat
ttccggcccgagctggacaccacccgcgtcgacgccgtcttccgcaagggcgcctacgcc
gcggggtacagcggcttcgagggcgtcgacgacaacgggacgccgctgctggaatggttg
cgccggcgcggggtcgacgaggtcgacgtggtcggcatcgccaccgaccattgcgtgcgg
cggaccgccgaggacgcggcgcgcgcgggcctgaccacccgggtgctggtgcacctgacc
gcggccgcagcggaggattcggcggcccgggcgctggacgaaatgcgaagcgccggaatc
gaattggtcggagcacgctga

DBGET integrated database retrieval system