KEGG   Mycobacterium avium 104: MAV_2796Help
Entry
MAV_2796          CDS       T00433                                 

Definition
FAD dependent oxidoreductase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mav  Mycobacterium avium 104
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mav00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mav00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mav00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2822398..2823363
Genome map
AA seq 321 aa AA seqDB search
MARNQQIVVIGAGVSGLTSAICLAEAGWPVRVWADTMPADTTSAVAGAVWAPPRPAERAA
ETLRWTEHSLRVFTELARDPDSGVQLAPALAVGELTASEAMSTAASLIPELRPADPADLP
PGYRTGFHATVPMIDMPHYLGYLTRRLTAAGGEIEEHRVGSLDEVADHADIVVNCAGLRA
GALTGDDTVRPLFGQHVVLTNPGVRQLFMELNDGPEWTCYFPHPQRVVCGGISIAGRWDT
TADPAVTERILQRCRRIEPRLGEAEVIEVITGLRPDRPSVRLQAEPLRRARCIHNYGHSS
NGVTLSWGCARDVLALVDDAR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaaccagcagatcgtcgtgatcggggccggcgtgagcggactgacgtcggcc
atctgtctggccgaggcgggatggccggtccgcgtgtgggcggacacgatgccggcggac
acgacctcggcggtggccggcgccgtctgggcaccgccgcggcccgccgaacgcgcggcc
gagacgctgcgctggaccgagcactcgttgcgggtgttcaccgaactcgcccgcgacccc
gattcgggtgtgcagctggcgccggcgctggctgtcggcgagctgaccgcctccgaggcg
atgtcgacggcggcctcgctgatccccgagctgcgcccggccgacccggccgacctcccg
cccggctatcgaaccggatttcacgccaccgtgccgatgatcgacatgccgcactatctc
ggctatctgacccggcggctgacggcggccggaggcgagatcgaggagcaccgggttggc
tcgctggacgaggtcgccgaccacgccgacatcgtcgtcaactgcgcgggcctgcgcgcg
ggcgcgctcaccggagacgacaccgtccggccgctgttcggtcagcacgtcgtgctcacc
aatcccggtgtgcgccaactgtttatggaactcaacgacggccccgagtggacctgctac
tttccgcacccgcagcgggtggtgtgcggcggcatcagcattgccggccgctgggacacc
accgcggaccccgccgtgaccgaacggattctgcagcgctgccgccgaatcgagccacga
ctgggcgaagccgaggtgatcgaggtgatcaccgggctgcggccggaccgtccgtcggtg
cgcctgcaggccgaaccgctccgacgggcacgctgcatccacaattacgggcacagcagc
aacggcgtcaccctgtcctggggttgcgcgcgtgacgtgctggccctggtggacgacgct
cgctga

DBGET integrated database retrieval system