KEGG   Mycobacterium avium 104: MAV_2812Help
Entry
MAV_2812          CDS       T00433                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mav  Mycobacterium avium 104
Pathway
mav00010  Glycolysis / Gluconeogenesis
mav00071  Fatty acid degradation
mav00350  Tyrosine metabolism
mav00625  Chloroalkane and chloroalkene degradation
mav00626  Naphthalene degradation
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01130  Biosynthesis of antibiotics
mav01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAV_2812
  Lipid metabolism
   00071 Fatty acid degradation
    MAV_2812
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAV_2812
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAV_2812
   00626 Naphthalene degradation
    MAV_2812
Enzymes [BR:mav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAV_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C NAD_binding_10 ThiF
Motif
Other DBs
NCBI-ProteinID: ABK67420
UniProt: A0A0H3A0C5
Position
2837922..2838890
Genome map
AA seq 322 aa AA seqDB search
MELVDTETRPPGRDEVRLTVGACGICGTDAHFVNGAFPGLSWPLTPGHEIAGRIAELGEG
VEGFAVGQRVAVGWFGGCCYRCDPCRAGLFIHCVNGKVPSWHYPGGYAESVTVPTSALAR
IPEELTDAEAAPMGCAGVTTYNALRHTKALPGDRVAILGVGGLGHLGVQFAAAMGFETIA
INRGTGKADDARKLGAHHYIDSTAEDPAEALRALGGAAVVLATAGNSQAMAATVGGLAPQ
GELVTIGVTPEPLPISPLQLITPGLSIVGHPSGTAKDVEDTMQFAVLSGVRAWIEELPLS
RAADGYAALEGGRAHYRTVLTM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttggaactggtcgacaccgaaacccggccgccgggccgggacgaggtacggctgacggtc
ggtgcctgcggcatctgcggcaccgacgctcacttcgtcaacggtgcattccccggcctg
tcgtggccgttgacgccggggcatgaaatcgccggccggatcgccgagctgggcgagggt
gtcgaagggttcgcggtcggccagcgggtcgcggtcggctggttcggcgggtgttgctac
cggtgcgacccttgccgcgcaggccttttcatccactgcgtgaacgggaaggtacccagc
tggcactatcccggcggatacgcggaatcggtgacggtcccgaccagcgcgctggcccgc
atccccgaggagctcaccgacgccgaagccgccccgatgggctgcgccggggtcaccacc
tacaacgccctgcggcacaccaaggcgttgcccggcgatcgggtggcgatcctgggggtc
ggcggcctgggtcatctcggcgtgcaattcgccgccgcaatgggtttcgagaccatcgcg
atcaaccgcggtaccggtaaagccgatgacgcccggaaactgggcgcccatcactacatc
gactccacggccgaagaccccgccgaagcgctgcgggcgttgggcggcgcggcggtggtg
ctggccaccgccggcaattcgcaggccatggccgccacggtcggcggtcttgcgccgcag
ggcgagctggtcaccatcggcgtcacgcccgagccgctgccgatcagtcccctgcagctg
ataacgccgggcctcagcatcgtcggtcatccctccggcaccgccaaggacgtcgaggac
accatgcagttcgcggtcctgtccggggtgcgcgcctggatcgaggagctgccgttgtcc
cgggcggccgacggctacgccgccctggaaggcgggcgagcgcattaccgcaccgttttg
accatgtga

DBGET integrated database retrieval system