KEGG   Mycobacterium avium 104: MAV_2880Help
Entry
MAV_2880          CDS       T00433                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mav  Mycobacterium avium 104
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mav01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mav00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mav00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2906905..2909109
Genome map
AA seq 734 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNDEALPGTDIDPDSFWAGVDKVVTDLTPRNQELLRRRDEL
QAQIDKWHRQRVIEPLDIDAYRDFLIEIGYLLPEPEDFTITTSGVDDEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGSSYNKVRGDKVIAYARNFLDQAV
PLESGSWADATGLSVEDGRLQVATADGSVGLAEPEKFAGYTGQLGSPDWSVLLVNHGLHI
EILIDPQSPVGKTDRAGIKDVVLESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDL
SEEVSKDGKTFTRVLNADRTYTTPDGQGELTLPGRSLLFVRNVGHLMTNDAIVLSDGDEE
KEVFEGIMDALFTGLTAIHGLKTGEANGPLQNSRTGSIYIVKPKMHGPDEVAFTCELFSR
VEDVLGLPQGTLKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAG
PMIRKGAMKNTTWIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKA
GATTAWVPSPTAATLHAMHYHYVDVGAVQEELAGKKRTTIEQLLTIPLAKELAWAPEEIR
EEVDNNCQSILGYVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITE
EDVRASLERMAPLVDAQNAKDAAYQPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILH
RRRREVKARAAQSN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgtcggcggggaacctgcgcgtcgcccgagtgctttacgacttcgtg
aacgacgaggccttgcccggcaccgacatcgacccggacagcttctgggcgggcgtcgac
aaggtggtcaccgacctcacccccaggaaccaggagctgctgcgccgccgcgacgagctg
caggcccagatcgacaagtggcaccgccagcgcgtcatcgagccgctcgacatcgatgcc
taccgcgacttcctcatcgaaatcggttacctgctgcccgaacccgaggacttcaccatc
accacctccggggtggacgacgagatcaccaccaccgcgggcccgcagctggtggtgccc
gtactcaacgcccggttcgcgctgaatgccgccaacgcccggtggggttcgctgtacgac
gcgctgtacggcaccgacgtgatccccgaaaccgacggcgccgaaaagggttcgagctac
aacaaggttcgcggcgacaaggtgatcgcgtacgcccgcaacttcctcgaccaggcggtg
ccgttggaatcgggttcctgggccgacgcgaccgggttgtccgtcgaggacggccgcctg
caggtggcgaccgccgacggttccgtcggcctggccgagccggagaagttcgccggctac
accgggcagctcgggtcgccggactggtcggtgctgctggtcaatcacggcctgcacatc
gagatcctcatcgacccgcagtcaccggtcggcaagaccgaccgcgccggcatcaaggac
gtggtgctggaatcggccgtcaccacgatcatggacttcgaggactcggtggccgccgtc
gacgccgacgacaaggtgctcggctaccgcaactggctcggcctgaacaagggcgacctg
tccgaagaggtcagcaaggacggcaagaccttcacccgggtgctcaacgccgaccgcacc
tacaccacccccgacggccagggcgagctgaccctgccgggccgcagcctgctgttcgtc
cgcaacgtcgggcacctgatgaccaacgacgccatcgtgttgagcgacggcgacgaggaa
aaagaggtgttcgagggcatcatggatgcgctgttcaccggcctgacggcgatccacggg
ctcaagaccggcgaggccaacgggccgctgcagaacagccgcaccggctccatctacatc
gtcaagcccaagatgcacgggcccgacgaggtcgcgttcacctgcgagctgttcagccgg
gtggaggacgtcctgggcctgccgcagggcaccctcaagatcggcatcatggacgaggaa
cggcgcaccaccgtcaacctcaaggcctgcatcaaggccgcggccgaccgggtggtgttc
atcaacaccggctttttggaccgcaccggcgacgagatccacacctcgatggaggccggg
ccgatgatccgcaagggtgcgatgaagaacaccacctggatcaaggcctacgaggacgcc
aacgtcgacatcgggctggccgccggcttcaagggcaaggcccagatcggcaagggcatg
tgggcgatgaccgaactgatggccgacatggtcgagcagaagatcggccagcccaaggcg
ggcgccaccaccgcgtgggtgccctcgccgacggcggccaccctgcacgccatgcactac
cactacgtcgacgtgggcgcggttcaggaggagctcgccgggaagaagcgcaccaccatc
gaacagctgctcaccatcccgctggccaaggagctggcctgggctcccgaggagatccgc
gaggaggtggacaacaactgccagtccatcctcggctatgtggtgcgctgggtcgcccag
ggggtcggctgctcgaaggtgcccgacatccacgacgtggcgctcatggaagaccgtgcg
acactgcggatttcgagccagctgctggccaactggctgcgccacggggtgatcaccgag
gaggacgtgcgggccagcctggagcggatggcgccgctggtggacgcccagaacgccaag
gacgccgcctatcagccgatggcgcccaacttcgacgacagcctggcgttcctggccgct
caggatctgatcctgaccggcacgcagcagcctaacggctacaccgagccgatcctgcac
cgccgccggcgcgaggttaaggcccgcgccgcgcagtcgaattga

DBGET integrated database retrieval system