KEGG   Mycobacterium avium 104: MAV_2880Help
Entry
MAV_2880          CDS       T00433                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mav  Mycobacterium avium 104
Pathway
mav00620  Pyruvate metabolism
mav00630  Glyoxylate and dicarboxylate metabolism
mav01100  Metabolic pathways
mav01110  Biosynthesis of secondary metabolites
mav01120  Microbial metabolism in diverse environments
mav01200  Carbon metabolism
Module
mav_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mav00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAV_2880 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MAV_2880 (glcB)
Enzymes [BR:mav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MAV_2880 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3375
Motif
Other DBs
NCBI-ProteinID: ABK64489
UniProt: A0QGM8
Position
2906905..2909109
Genome map
AA seq 734 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNDEALPGTDIDPDSFWAGVDKVVTDLTPRNQELLRRRDEL
QAQIDKWHRQRVIEPLDIDAYRDFLIEIGYLLPEPEDFTITTSGVDDEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGSSYNKVRGDKVIAYARNFLDQAV
PLESGSWADATGLSVEDGRLQVATADGSVGLAEPEKFAGYTGQLGSPDWSVLLVNHGLHI
EILIDPQSPVGKTDRAGIKDVVLESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDL
SEEVSKDGKTFTRVLNADRTYTTPDGQGELTLPGRSLLFVRNVGHLMTNDAIVLSDGDEE
KEVFEGIMDALFTGLTAIHGLKTGEANGPLQNSRTGSIYIVKPKMHGPDEVAFTCELFSR
VEDVLGLPQGTLKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAG
PMIRKGAMKNTTWIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKA
GATTAWVPSPTAATLHAMHYHYVDVGAVQEELAGKKRTTIEQLLTIPLAKELAWAPEEIR
EEVDNNCQSILGYVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITE
EDVRASLERMAPLVDAQNAKDAAYQPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILH
RRRREVKARAAQSN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgtcggcggggaacctgcgcgtcgcccgagtgctttacgacttcgtg
aacgacgaggccttgcccggcaccgacatcgacccggacagcttctgggcgggcgtcgac
aaggtggtcaccgacctcacccccaggaaccaggagctgctgcgccgccgcgacgagctg
caggcccagatcgacaagtggcaccgccagcgcgtcatcgagccgctcgacatcgatgcc
taccgcgacttcctcatcgaaatcggttacctgctgcccgaacccgaggacttcaccatc
accacctccggggtggacgacgagatcaccaccaccgcgggcccgcagctggtggtgccc
gtactcaacgcccggttcgcgctgaatgccgccaacgcccggtggggttcgctgtacgac
gcgctgtacggcaccgacgtgatccccgaaaccgacggcgccgaaaagggttcgagctac
aacaaggttcgcggcgacaaggtgatcgcgtacgcccgcaacttcctcgaccaggcggtg
ccgttggaatcgggttcctgggccgacgcgaccgggttgtccgtcgaggacggccgcctg
caggtggcgaccgccgacggttccgtcggcctggccgagccggagaagttcgccggctac
accgggcagctcgggtcgccggactggtcggtgctgctggtcaatcacggcctgcacatc
gagatcctcatcgacccgcagtcaccggtcggcaagaccgaccgcgccggcatcaaggac
gtggtgctggaatcggccgtcaccacgatcatggacttcgaggactcggtggccgccgtc
gacgccgacgacaaggtgctcggctaccgcaactggctcggcctgaacaagggcgacctg
tccgaagaggtcagcaaggacggcaagaccttcacccgggtgctcaacgccgaccgcacc
tacaccacccccgacggccagggcgagctgaccctgccgggccgcagcctgctgttcgtc
cgcaacgtcgggcacctgatgaccaacgacgccatcgtgttgagcgacggcgacgaggaa
aaagaggtgttcgagggcatcatggatgcgctgttcaccggcctgacggcgatccacggg
ctcaagaccggcgaggccaacgggccgctgcagaacagccgcaccggctccatctacatc
gtcaagcccaagatgcacgggcccgacgaggtcgcgttcacctgcgagctgttcagccgg
gtggaggacgtcctgggcctgccgcagggcaccctcaagatcggcatcatggacgaggaa
cggcgcaccaccgtcaacctcaaggcctgcatcaaggccgcggccgaccgggtggtgttc
atcaacaccggctttttggaccgcaccggcgacgagatccacacctcgatggaggccggg
ccgatgatccgcaagggtgcgatgaagaacaccacctggatcaaggcctacgaggacgcc
aacgtcgacatcgggctggccgccggcttcaagggcaaggcccagatcggcaagggcatg
tgggcgatgaccgaactgatggccgacatggtcgagcagaagatcggccagcccaaggcg
ggcgccaccaccgcgtgggtgccctcgccgacggcggccaccctgcacgccatgcactac
cactacgtcgacgtgggcgcggttcaggaggagctcgccgggaagaagcgcaccaccatc
gaacagctgctcaccatcccgctggccaaggagctggcctgggctcccgaggagatccgc
gaggaggtggacaacaactgccagtccatcctcggctatgtggtgcgctgggtcgcccag
ggggtcggctgctcgaaggtgcccgacatccacgacgtggcgctcatggaagaccgtgcg
acactgcggatttcgagccagctgctggccaactggctgcgccacggggtgatcaccgag
gaggacgtgcgggccagcctggagcggatggcgccgctggtggacgcccagaacgccaag
gacgccgcctatcagccgatggcgcccaacttcgacgacagcctggcgttcctggccgct
caggatctgatcctgaccggcacgcagcagcctaacggctacaccgagccgatcctgcac
cgccgccggcgcgaggttaaggcccgcgccgcgcagtcgaattga

DBGET integrated database retrieval system